CAZyme Information: FGRAMPH1_01T12223-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T12223-p1
• CAZy Family: GH127
• CAZyme Description: Chitin synthase 7

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
744		83694.02	8.1128

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:4411736-4414074(-)

Full Sequence      

MEALNMRPRSALSSFEAKKAYFGNDFADLKKTINSSTIQEDEQPRFDRHRSWQNASFSST
AETVVGNDEPEPLKDFSTLHIENPLPPLPPKIIDEPLFPSHTENITPLFNLKAAPARNPL
HAVTIEDDDDNICPLEKDPKKAAPTVSVTEKPVQVTPMHANSTVETCGYPEIEDPVDPAR
ILSKKDLFNQRVAFMGLVVIINICMAITAFFGKKSKLVFIVVLFVKSKDFLSAILSPTGM
IYRAIYEKFYPPGPVTRRWILSLIPAYSESEEQIVKTIFSLRDNGVEPHRQVMVVILDGK
PRDVRSHMIRMVREFQRPYVSLKWKKGVLNILAGFMEDVPVIVIEKVKNAGKKDSLVLCH
DLFNYPRENSPLYTQLLRKEMWDEILPELTKGEEFNGFDMVFCTDADSTIYKGAVALLAN
ALARDKDAIAACGLVLVELEPGYEWSFWNLYQQFQYTFGQYVRRRAEGFVGKVTCLPGCI
TMMAVRPEMAGAIRKYSEPVTGELVIHHQVQYLGTDRRLTYSMLSQGKHLRTLFVPDAVS
ETVAPQSLFHYLSQRRRWGSNAYFNNYFYLAGEKMIPITRIAASIEVIRLSLVYYRILNT
ALFIASCVRHITALKLVPMLVVGQLPSLWFFCSILLEPVLRKRGHKLLIGYLINKCVSPF
MSVIIFTKVATNLGSQVWGVSGVTASSAAPPTAAPGSGEVDKKIVTDALDAAERGEVVPS
MNQDTGGLTKPERARLRDERVEVE

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T12223-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	346	625	1.2e-25	0.538899430740038

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367353	Chitin_synth_2	1.57e-26	248	558	16	370	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133033	Chitin_synth_C	2.92e-24	401	565	77	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
224136	BcsA	8.13e-10	399	670	139	401	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133056	GT2_HAS	0.002	446	565	122	235	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
404520	Glyco_tranf_2_3	0.005	441	558	129	227	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCB65760.1|GT2	0.0	1	744	1	744
CZS81212.1|GT2	0.0	6	744	1	739
CEI61656.1|GT2	0.0	1	744	1	743
QKD60377.1|GT2	0.0	1	744	1	751
CCT74940.1|GT2	0.0	1	744	1	748

PDB Hits     

FGRAMPH1_01T12223-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|J9VNT4|CHS5_CRYNH	8.22e-23	258	565	1253	1588	Chitin synthase 5 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS5 PE=2 SV=1
sp|O13395|CHS6_USTMA	1.16e-22	258	565	407	742	Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS6 PE=3 SV=2
sp|J9VF17|CHS4_CRYNH	1.72e-20	258	565	506	841	Chitin synthase 4 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS4 PE=2 SV=2
sp|Q4P333|CHS7_USTMA	2.27e-20	259	565	459	801	Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS7 PE=3 SV=1
sp|O13394|CHS5_USTMA	1.37e-17	252	565	786	1149	Chitin synthase 5 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS5 PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000000

TMHMM  Annotations     

Start	End
192	211