CAZyme Information: FGRAMPH1_01T12165-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T12165-p1
• CAZy Family: GH125
• CAZyme Description: unsaturated rhamnogalacturonyl hydrolase yter

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389		44259.69	4.5610

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:4342214-4343479(-)

Full Sequence      

MKYLLWAMLLSAVFAQAESSYLTRMADTMIAKGVSPDRGYQDAVLYLGFEKAYELSGDDK
YLDWYIGQIAGPVVLEDGTIKGLNTSKYILDEYRMGHNYLYLYKETGHEKYKIAANTIRR
MLDKYPRTPLGGFWHQQFFRNQMWLDGIYMADTFYAKWTSLYDRDNDTAWNDILLQYELI
HEHTGNETTGLHVHGWVDGTASWADPKTGRAPNVWGRALGWYFMSLVEVLQFFPTSHDGY
GQLHGYLESVALGLKESRDPASGSWWQVMNEPYPGRKGNFIESSGSSMFTWGLLKAIDLG
YLDRSEYLDTARDAFTSIVSNFIEADEDGPIILNSTVAECGLLSSNVTFEYYVGQPTLDN
GQNGVGPFMLAAYEWESWAKDAEAEVRCL

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T12165-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	35	376	1.3e-89	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400034	Glyco_hydro_88	2.36e-64	21	376	1	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
226678	YesR	1.47e-62	21	376	15	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF77886.1|GH105	1.06e-302	1	389	1	389
CZS81183.1|GH105	1.44e-300	1	389	1	389
QPC59199.1|GH105	1.60e-288	1	389	1	389
QPC70588.1|GH105	6.24e-286	1	389	1	389
CEI61629.1|GH105	5.54e-260	1	382	1	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	7.59e-80	21	377	4	360	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.25e-51	40	382	41	371	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	5.32e-51	40	382	31	361	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]
5NOA_A	1.17e-08	36	374	49	370	Polysaccharide Lyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	8.11e-08	105	374	105	353	Chain A, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	6.45e-51	40	382	41	371	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	9.69e-25	190	374	38	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	9.69e-25	190	374	38	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000478	0.999459	CS pos: 17-18. Pr: 0.9530

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T12165-p1.