CAZyme Information: FGRAMPH1_01T12155-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T12155-p1
• CAZy Family: GH125
• CAZyme Description: beta-glucosidase I

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
834		92381.41	5.0551

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:4327629-4330133(-)

Full Sequence      

MTPSQATTDLVSKLTVEEKVSLLAAVDWWRTPTIKRDDVFIPHIKTSDGPNGARGESYVS
GITAACFPCSTALGASFDQEQAYRMGEEIAKETITKSANVLLAPTMNIIRSPLGGRNYET
YSEDPYLIGTLASAFVRGCQSQGIAATPKHFVANDSEKSRTKMTSNIDMQTLREIYLLPF
QLVLRDSDPWCFMTSYNRLNEEYCADSHWLLEEILRKEWGFSGLVISDWMGTYSTAKSLN
AGMDLEMPGPTRWRGKKLIAEIEAGNVSMEVLDKSVGRVIDLAKKTGRFDDPVEKPERSV
EDPARIEYITAVAADGMVLLKNDNNVLPLSEHDSVAVIGHFALQPSIGGGGSAKVLAQHI
VSPLQGLKSRGVTCRFAPGVPVFGALPHAVPDSISEVQLRWFNGSVVGENLAHEQTVALP
EYMIKEAWPDYLRKDYCSSMSFNLIPKTSGDHIFSVITTGKADVIVNGENVFHRPQEPVL
LPESFYFYKAKIERRFAFNMTAGQEYNVELRSWATDEDVLSRIGGTMFQGASLRFMEHID
IPRAISDAADAAGSSDTAVVFVGTTNEMESEGYDRDTMDLTSDQYDLIAAVVARNPQTVV
VNLSGSPVTVSPFIDQVPTFLQAWFAGQECGHAIVRVLLGDVNPSGRLPMSWPRRNEDNP
AYPNFPCNDDLVLNYEERLKIGYRFYDDKSAPTPQFHFGQGLSYTTFALKGQPSFTSCFS
SAEETAVSVSTQVENTGNRDGKQVIQVYVTFPSCNVNHRPVKELKAYHKVRVPAGQAKSV
MFKLDKYAFSYFDAEEGKWRIPEGEFLVHLAFSSTEVLQTFSVTNATPQFWTGL

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T12155-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	40	248	1.3e-64	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	9.13e-79	67	819	120	759	beta-glucosidase BglX.
224389	BglX	3.71e-71	41	368	60	384	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.18e-51	317	683	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	6.09e-47	67	282	88	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.50e-44	10	804	56	762	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF77881.1|GH3	0.0	1	834	1	834
CZS81178.1|GH3	0.0	1	834	1	834
QPC59196.1|GH3	0.0	1	834	1	834
QPC70584.1|GH3	0.0	1	834	1	834
CEI61625.1|GH3	0.0	1	834	1	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	3.11e-172	10	834	9	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	8.31e-169	10	834	9	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	6.60e-126	10	823	8	666	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.94e-112	4	824	2	662	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.91e-101	9	823	6	713	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CAF5|BGLI_ASPTN	1.44e-177	11	834	10	839	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	2.79e-177	11	834	10	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q5BFG8|BGLB_EMENI	2.99e-175	10	817	14	830	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|Q4WU49|BGLI_ASPFU	1.50e-173	11	834	10	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	1.50e-173	11	834	10	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999771	0.000237

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T12155-p1.