CAZyme Information: FGRAMPH1_01T11755-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T11755-p1
• CAZy Family: GH11
• CAZyme Description: pectate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
249	HG970333|CGC12	25971.16	7.6409

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:3897337-3898159(-)

Full Sequence      

MKYATILALAGVSSAAVTKTLPKSAGVTSFPTAVPVKGSFDGGMKRFERSTNVCQGQTET
GEKDAMFILEAGATLSNVIIGASQAEGVHCKGTCPFDSNLAISTLNNVWWADVCEDAITL
KQTSGTSFINGGGAFKASDKIVQFNGRGTVQIKDFYAEDYGKLVRSCGNCKDNGGPRNVI
IQDSVAVNGGVLCGINTNYGDTCKITNTCQNSGKYCDRYQGNSDGSEPSKIGSGPDGKFC
ITSGATKTC

Enzyme Prediction     

EC	4.2.2.2:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	28	221	5.6e-76	0.9742268041237113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	1.01e-108	18	226	1	200	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF77681.1|PL3_2	1.40e-182	1	249	1	249
CZS80976.1|PL3_2	1.40e-182	1	249	1	249
QPC59022.1|PL3_2	3.17e-174	1	249	1	247
QPC70429.1|PL3_2	1.86e-169	1	249	1	240
CEI61437.1|PL3_2	7.25e-167	1	249	1	240

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	3.01e-30	34	168	11	135	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
3B90_A	9.69e-21	47	221	9	196	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B90_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
3B4N_A	1.57e-20	24	221	100	314	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B4N_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_A Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
4EW9_A	1.04e-18	58	169	38	139	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	1.06e-18	58	169	39	140	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B024|PLYF_EMENI	5.18e-61	22	232	28	229	Probable pectate lyase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyF PE=3 SV=2
sp|B0Y953|PLYF_ASPFC	1.07e-60	40	232	46	230	Probable pectate lyase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyF PE=3 SV=1
sp|Q4WKV8|PLYF_ASPFU	1.52e-60	40	232	46	230	Probable pectate lyase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyF PE=3 SV=1
sp|A1DBJ7|PLYE_NEOFI	4.47e-59	21	235	36	241	Probable pectate lyase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyE PE=3 SV=1
sp|A1C4B8|PLYE_ASPCL	4.47e-59	21	249	36	254	Probable pectate lyase E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=plyE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000415	0.999564	CS pos: 15-16. Pr: 0.9708

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T11755-p1.