CAZyme Information: FGRAMPH1_01T11497-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T11497-p1
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase yteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		44398.03	6.0142

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:3608646-3609848(+)

Full Sequence      

MKFQSVCLALASANMALANNLLANLADSWIRNNHETQRPYWYGRAVVFEGYEAAIELTKN
QTLVDWYRGQMDLVVADNGTIINYDMSKHSLDNYRIGMNLIWWYKRTGEEKYKQAADFIR
DRINQHPRTPTGGFWHREPTYPDQMWLDGIFMADSFYAVWTKEFDAKNTTAWDDIVLQWD
KIQEVTIDKETGLPVHGFDESKIAVWADPETGASPIVWSRAVGWYFWSLIEVLDVFPKSH
PGYKRLRTYYKDLASALLRAQGHESHLWELVMNKEYEGVEGNYIESSASAMFTYGWLAGL
RRGLLDEKTYTKPAKQAYKRLYRDFVTKHKNGTLTWEGTVEVGSLNSDASFEYYTEVPVV
PNDTRGHGPYMMAVYEWEVRNK

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T11497-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	33	378	1.1e-95	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	2.55e-58	27	378	21	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	3.12e-57	42	378	29	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF77552.1|GH105	2.29e-298	1	382	1	382
CZS80847.1|GH105	1.88e-297	1	382	1	382
QPC70328.1|GH105	5.39e-297	1	382	1	382
QPC58920.1|GH105	4.43e-296	1	382	1	382
CEI61323.1|GH105	2.96e-285	1	382	1	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.34e-75	25	378	8	359	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.65e-49	16	378	19	365	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	7.03e-49	16	378	9	355	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4Q88_A	1.03e-06	106	321	105	307	Chain A, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	8.50e-49	16	378	19	365	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	2.44e-27	173	376	20	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	2.44e-27	173	376	20	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000443	0.999541	CS pos: 18-19. Pr: 0.9722

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T11497-p1.