CAZyme Information: FGRAMPH1_01T11427-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T11427-p1
• CAZy Family: GH105
• CAZyme Description: unnamed protein product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
684		78622.75	6.0607

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:3533168-3535222(+)

Full Sequence      

MSHPQSTFHHTTFTPGSVLYRRRTTVAKTTLHTQLKHLRETGRYDCFKLQWHEIYDDKSM
WPVPFHLFWDSDIAKWIEGACYFLHDEFDAEIDAAVKELVDTISGAQQDDGYLNVHYTVV
EPGKRWTNLQDMHELYVPQLALCLSPLITYIYVRYNAGHLIEAAVAHHHYYKNNLLLGPI
EKYVALIHQTFGPAENQLHGYPGHPEIELALFRLYQATGNQAAYELSRYFIEERGNKTGQ
AGEHYFEWESKKRGQNPYQRPDSYPEHGSHWYCQANKPIMEQDTVEGHSVRAMYLLTAVA
DMICIDKQPLQASTDWKKTLYRLWNNMVDKKMYLTGGIGAIKQWEGFGRDYFLPQSTDEG
GCYAETCASIAVMMLAERLLHIELDGRFADVMELCLYNNVMTSMSLDGKAFTYVNQLGSS
ESDKSVREEWFWCACCPPNVTRLYGSLGGYLWDFGETSEDEVYINVHLYSKASLKFEVAG
KEVSLEQDSNWPWDGLVKFRLSAPESLKTTIRLRIPGWSRDQYRMSPEPSQGNFHIHKGY
IALSSSYVSKNPEFSLNIGNFKPLYIAPHPYTNQRTLTLTRGPVVYCMEDADNVWEDNHF
KDVGLKAAMEVEEERKTIGDEEYVALKTSCWRRILEDTETGAAPGTLVDCEEHVGTKMEA
VFVPYYLRANRGGNGHMRVGLNRI

Enzyme Prediction     

EC	3.2.1.185:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	154	587	6.9e-131	0.7729007633587787

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226063	COG3533	1.60e-129	8	683	9	587	Uncharacterized conserved protein, DUF1680 family [Function unknown].
400342	Glyco_hydro_127	1.16e-95	12	587	3	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF77516.1|GH127	0.0	1	684	1	684
CZS80809.1|GH127	0.0	1	684	1	684
QPC58890.1|GH127	0.0	1	684	1	665
QPC70296.1|GH127	0.0	1	684	1	665
CEI61286.1|GH127	0.0	1	684	1	667

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	4.99e-114	67	593	73	566	Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	5.27e-109	67	593	73	566	Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	3.56e-84	67	679	72	654	The crystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	4.56e-84	67	679	72	654	Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
7EXU_A	1.24e-83	67	679	72	654	Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E8MGH8|HYBA1_BIFL2	1.83e-83	67	679	72	654	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T11427-p1.