CAZyme Information: FGRAMPH1_01T11281-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T11281-p1
• CAZy Family: GH10
• CAZyme Description: sterol glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
714		77145.36	8.1803

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:3334732-3336923(+)

Full Sequence      

MKPPYGHRVRICTHAAFKEFVEAQGVEFFNIGGDPEALMAYMVKNPGLLPNRDSLKGGEV
GKRRKEMAEIISGTWRSCIEAGDGMGEPIKAANVESTDDLFLADVIIANPPSMGHIHCAQ
KLSIPLHMVFTMPWSPTKSFPHPLASMSYGDADAKVANYLSFMMMELLTWQGLGDLINKF
RTQTLHLDPVSPLWGFQLISRLRIPFSYLWSETLIPKPSDWDSHLNITGFSFLPLASSYT
PPPDLVSFLDNGSTPIYIGFGSIVVDNPQALTTMIFEAIKIAGVRAILSKGWGGVGTGDV
PDSVYLIGNCPHDWLFQRVAAVVHHGGAGTTAAGIAAGRPTVIVPFFGDQPFWGQMMARA
GAGPVAVPYKDLTAEILAESITFALQPGVMAVAKDMALQIGEEDGSGGAAMDIQDRLDID
SLRCDLSPGRLASWLHRKTGAHLSGFAVGCLRDHGLIEMSDLKLLRYKHWYVDEGAESPI
IGAIAAVSGFAAAIGTATSDYTQRLRNSPHSKSTRRHSSIGLQRVPKTEDGTNDAYLRSQ
KGPRDVTQADMEALAQKMASKTLYGAEPAFSAARLCRPVSEARQGRKNSWKARESGRNGR
VFYVTRVTGKYACDLAAATARAPVALFYNVANGFHNAPSNVFDVDVRRRDEITGLGSGVK
TAGKEFCYGIWDAFSGIVMKPYEDTKNMGAKGLGRGLLRGGLGIIGNLGSGKLC

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	98	410	1.5e-52	0.7408376963350786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	2.76e-56	6	410	28	398	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	4.20e-25	6	410	29	392	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	3.46e-10	5	141	25	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	0.002	256	413	228	386	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCB65698.1|GT1	0.0	1	714	1	714
CZS80737.1|GT1	0.0	1	710	117	826
QPC70230.1|GT1	0.0	1	713	117	829
QPC58826.1|GT1	0.0	1	710	117	826
CEI61215.1|GT1	0.0	1	710	117	826

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	3.56e-68	6	418	47	440	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	5.83e-68	6	418	67	460	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
3H4I_A	6.04e-28	174	410	150	374	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1IIR_A	1.03e-26	112	422	106	398	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
1RRV_A	5.84e-21	174	410	167	392	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Z7|U80A2_ARATH	2.23e-117	5	409	219	602	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q9XIG1|U80B1_ARATH	1.19e-113	5	409	182	566	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q6C8M8|ATG26_YARLI	1.04e-68	6	418	1022	1414	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
sp|P0CN90|ATG26_CRYNJ	5.43e-67	6	444	1061	1497	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=ATG26 PE=3 SV=1
sp|P0CN91|ATG26_CRYNB	5.43e-67	6	444	1061	1497	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T11281-p1.