CAZyme Information: FGRAMPH1_01T10749-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T10749-p1
• CAZy Family: CE8
• CAZyme Description: glucan -beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
850		93721.97	9.3348

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:2536415-2539179(+)

Full Sequence      

MRSRNILPLWLLWLTQGQVSALPQVDQDSSNSQNDEVIGDIQTSAFEYPTTYAKEDIIPV
TETVKVSTSKVGTTATAQVLPSLSDVEPHTEGFIVTDLYNPFFTKPAVLSTSIPSPTSLL
KPVKTTTKNAEPSGLSKMAAAADIFASPIDTGAPLSMFARKDTHPVSKDAVKQNSPIGTN
KFYSNFYLEDQNTPVYTYPYSLTWAKGTGPSASWGMSISHIDADKRTYGPVGANGAVEFY
TNPVSIQPMVISAKELGKNTVLTMDSISPHFAKAYLRKDSKSAATITFPLYQGSVFTTAY
FSGGTPWIQSGVYFRTMTQVTKDPKTNVRKYNFVLEDGTTWRLYAYKTKGDPLTLQVTNN
GLAVSQKPFYGHIQIAKDPKVGQSEQVLDNGCGIYATGMTISGNNVGTQGTYKFTWTKAG
HATGKLWIFALPHHISSFDAATTKEMRTYSMQTLTKGVAKAVGGNSWTMIEPSLPVNMGF
APWDPVKGSRGLSANAKKIIAPIAKSEVSQDMDAQSNTDSMYFSGKALAKFGSVVYVINN
MLGDTALAQAGLEKLKTAFARFGSNKQKFPLVYESVWGGIVSTASYVSGSAGSDFGNTYY
NDHHFHFGYHVLTAAYIGSMDSKWLAANKAYVNTLVRDYANPSSSDKYFPQWRSFDWYHG
HSWAHGLTPMWDGKDQESSSEDMMSVYAMKMWGTVIKDTNMVARANLQLAVMSRAMQAYY
YYTTTNTVQPKNFIGNKVAGILFENKVHHTTWFSADIEAVQGIHMIPILPFSNLARTGTF
VQQEWETYFNKGRVDKFNNLWKGIIYGNYATIQPNAAWSFFTQSKFDPIWIDGGASRTWY
MAYAAALGSI

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	169	843	1.1e-207	0.9807073954983923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	125	848	35	756	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	491	841	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	1.06e-133	164	485	1	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CZS80468.1|GH81	0.0	1	850	1	850
CEF77177.1|GH81	0.0	1	850	1	850
QPC58611.1|GH81	0.0	1	845	1	845
QPC70015.1|GH81	0.0	1	845	1	845
CEI60967.1|GH81	0.0	1	850	1	856

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	3.43e-84	150	846	7	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	5.58e-84	150	846	32	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	6.42e-83	150	827	7	703	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	7.96e-28	177	824	35	637	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.54e-17	522	817	361	654	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	4.81e-218	110	845	162	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	1.50e-169	148	848	6	703	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	8.65e-151	108	847	12	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q12168|ENG2_YEAST	2.34e-140	143	846	74	777	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|P53753|ENG1_YEAST	6.07e-139	149	849	406	1114	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000257	0.999713	CS pos: 21-22. Pr: 0.9770

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T10749-p1.