CAZyme Information: FGRAMPH1_01T10377-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T10377-p1
• CAZy Family: CE5
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
773		84527.93	5.2162

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:2008907-2011479(-)

Full Sequence      

MKLSAYVCAAVLATAGQAAKDKPVYKDAKASVDDRVSDLLKRMTIQDKAAQLIQGDMTNY
LNLTTEAVNKTGLEWNFKYRANSIWTGLYANMTTIKKAAKVGQDYLMKETELGIPAFIQS
EGLHGVLILNGTIFNSPIGMGCSFNPELIEKMADIIATESRAVGINQLFSPQVDLARELR
FGRVEECFSEDPYLAGEMGYSYVKGLQAGGVSAMVKHYAAFATPEQGINTAPVHGGEREL
RSLYLPPFKRAIIDGGATSIMSSYNSYDGVPVVSDSHLLTDILRDEWDYKYYVISDAGGT
ARLAQAFHVCPLEDDECITLEALPAGNDAEMGGGYWSFEIIPELVKAGKLDEKIVDTAVS
RVLRSKFEMGLFEKPFTGVADDKIWDYVNTKAHKKVARQLDAESIVLLENHENVLPLKKD
ANIAVIGPMAHGYVNVNNYGDYVIHTAMTRGVTPYDGIKAASKGKVTFTQGCERWSSDES
KFEDAVAAAEAADVAVVVVGTWTRDQNELWGGLNATTGEHIDASNLNLIGAMPKLVKAII
DTGKPTVVVYSSGKPITEPWISKEAAALVQQFYQSQEGGHALADILYGNVNPSGKLSVSF
PYDVGTTPIYYDYLNSARASPNPGKIYENGTLEFGSNYILENPEALYTFGYGLSYSKFDF
SKISVSKKNVTSSDTVTVSVNVSNKSKRDGSEVVQLYVKDMLSSVDVPRYQLKGFKKVAV
KAGKTETVKIDLKVEEWGLWNRKMKYVVEPGDFTVFVGNSSENFMGNVTVTVA

Enzyme Prediction     

EC	3.2.1.120:1	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	108	331	1.1e-64	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	4.36e-155	1	761	2	754	beta-glucosidase BglX.
224389	BglX	1.89e-83	43	470	1	395	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	1.57e-63	112	759	79	770	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	7.98e-61	44	364	1	315	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	9.01e-44	405	655	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CZS80283.1|GH3	0.0	1	773	1	773
CEF76991.1|GH3	0.0	1	773	1	773
QPC69863.1|GH3	0.0	1	773	1	770
QPC58466.1|GH3	0.0	1	773	1	772
CEI60795.1|GH3	0.0	1	773	1	770

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	0.0	21	772	3	756	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	0.0	21	772	3	756	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	4.25e-120	11	763	25	776	Chain A, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5TF0_A	8.37e-117	27	763	2	742	Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5XXL_A	2.77e-111	32	763	10	743	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33363|BGLX_ECOLI	8.15e-122	33	761	35	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|Q56078|BGLX_SALTY	3.16e-121	33	761	35	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	1.95e-117	64	772	16	722	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|T2KMH9|PLH34_FORAG	3.72e-102	25	764	29	747	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
sp|P14002|BGLB_ACET2	2.23e-97	112	772	35	668	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000260	0.999702	CS pos: 18-19. Pr: 0.9803

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T10377-p1.