CAZyme Information: FGRAMPH1_01T10321-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T10321-p1
• CAZy Family: PL1
• CAZyme Description: endochitinase 2 precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
928		96531.29	4.0752

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:1917707-1920600(-)

Full Sequence      

MDRSPVPVTGAPVIQAFGGLNGYWGQLGSEPLKAYCDSHPEYITLSFVNQAPEQNPSNLP
GTNFAGHCAGGTYGNSNLLSECYTIQEGIPYCKDRGVKILLSIGGVYSDEGSNYKVTTDD
KGRDFADFLYKSFGPHNEHSNPIRPFDSIDNDGNTVHAAVDGFDFDIEHDLPNGPYIAMI
NRLRELDEGLTITGAPQCPTSDEYFYMKDMIKSAKFDALFVQFYNNPWCDAVSQGHEGES
FNYDKWVEIIEESDCSKDAKLYVGLPASEEAAPGGGYLEPEDLKDLVCELTTKPHFGGVS
LWDLTRGAGNIIEGKSYNEHVMDALKYGCDLVSVPTTTTSAMTTTTEEASTSTNITTTEA
TTVHTTTTSDVSTTSGASSTEDATSTDITTASDVSSMEEATATSDVSASASTDATTSMDA
TSTDTAASTDTAASTEAVASTYTTAATNSDASTSADVATSMDAATSTDATASADATASTD
VTTSSDASVSTDATASTETTATGANTSSVVTDPAASGVSATATESSADTATDSTTDSASK
SDVLSATSDLTVTSDTSSVTGAASSSTIDAPVESDTATGTAATTNVSGATEPTTIATAYS
TYRGWNTTSTGAAAYTQAYGNPTTLAHSGSLTTEGSPAYTNYPGNTGAVSMTTSTVCTTR
VHTVTQCPPEVVDCLFGSVTTETIPLYTTVCPVTDKAKHTGYATQYAPPPQYETRTVYTT
SVHAINKCAPGVVDCPYGSVTTETIPVYTTICPVTETYNQAPTDVPVNHEIKTLYTSQAH
TVAQCQPENPNCQVGAVTTEIASWTTAIVPAHETQLMKAYKPAAELPKPLTVESHLNGTV
YTSVVVPPATLKTATKPGVFEQARPTYKQTAQEQHSGAAAPTGGRNDKGPIETYAPAPIT
PATAGASSMVVGLTALAGIALLQVVALW

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T10321-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119356	GH18_hevamine_XipI_class_III	6.47e-103	18	323	1	280	This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain. Hevamine is a class III endochitinase that hydrolyzes the linear polysaccharide chains of chitin and peptidoglycan and is important for defense against pathogenic bacteria and fungi. PPL2 (Parkia platycephala lectin 2) is a class III chitinase from Parkia platycephala seeds that hydrolyzes beta(1-4) glycosidic bonds linking 2-acetoamido-2-deoxy-beta-D-glucopyranose units in chitin.
395573	Glyco_hydro_18	1.15e-12	22	315	4	273	Glycosyl hydrolases family 18.
411231	MSCRAMM_ClfA	5.86e-09	376	575	583	787	MSCRAMM family adhesin clumping factor ClfA. Clumping factor A is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). It is heavily studied in Staphylococcus aureus both for its biological role in adhesion and for its potential for vaccination. Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.
411231	MSCRAMM_ClfA	7.16e-08	377	630	619	868	MSCRAMM family adhesin clumping factor ClfA. Clumping factor A is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). It is heavily studied in Staphylococcus aureus both for its biological role in adhesion and for its potential for vaccination. Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.
411231	MSCRAMM_ClfA	1.16e-07	376	575	591	793	MSCRAMM family adhesin clumping factor ClfA. Clumping factor A is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). It is heavily studied in Staphylococcus aureus both for its biological role in adhesion and for its potential for vaccination. Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF76964.1|GH18	0.0	1	928	1	928
CZS80255.1|GH18	0.0	1	928	1	928
QPC58442.1|GH18	0.0	1	928	1	931
CEI60769.1|GH18	0.0	1	927	1	934
QGI83062.1|GH18	1.58e-269	19	927	15	850

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XTK_A	7.60e-55	17	325	1	308	ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XTK_B ChiA1 from Aspergillus fumigatus in complex with acetazolamide [Aspergillus fumigatus A1163],2XUC_A Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_B Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XUC_C Natural product-guided discovery of a fungal chitinase inhibitor [Aspergillus fumigatus],2XVP_A ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163],2XVP_B ChiA1 from Aspergillus fumigatus, apostructure [Aspergillus fumigatus A1163]
2XVN_A	1.90e-54	23	325	6	307	A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_B A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus],2XVN_C A. fumigatus chitinase A1 phenyl-methylguanylurea complex [Aspergillus fumigatus]
4TX6_A	1.96e-54	23	325	7	308	AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163],4TX6_B AfChiA1 in complex with compound 1 [Aspergillus fumigatus A1163]
2UY2_A	1.62e-39	23	325	11	287	ScCTS1_apo crystal structure [Saccharomyces cerevisiae],2UY3_A ScCTS1_8-chlorotheophylline crystal structure [Saccharomyces cerevisiae],2UY4_A ScCTS1_acetazolamide crystal structure [Saccharomyces cerevisiae],2UY5_A ScCTS1_kinetin crystal structure [Saccharomyces cerevisiae],4TXE_A ScCTS1 in complex with compound 5 [Saccharomyces cerevisiae]
2GSJ_A	3.05e-37	18	303	1	254	cDNA cloning and 1.75A crystal structure determination of PPL2, a novel chimerolectin from Parkia platycephala seeds exhibiting endochitinolytic activity [Parkia platycephala]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q873Y0|CHIA1_ASPFM	9.47e-52	11	342	17	350	Endochitinase A1 OS=Neosartorya fumigata OX=746128 GN=chiA1 PE=1 SV=1
sp|Q4WEP7|CHIA1_ASPFU	5.02e-51	11	342	17	350	Endochitinase A1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=chiA1 PE=3 SV=1
sp|A2QUQ2|CHIA1_ASPNC	2.07e-49	7	342	17	353	Endochitinase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=ctcA PE=2 SV=1
sp|G5EB30|CHIA1_EMENI	4.17e-46	23	339	33	349	Endochitinase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chiA PE=1 SV=1
sp|Q92223|CHIA1_EMEND	4.17e-46	23	339	33	349	Endochitinase A OS=Emericella nidulans OX=162425 GN=chiA PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T10321-p1.