CAZyme Information: FGRAMPH1_01T09849-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T09849-p1
• CAZy Family: CE4
• CAZyme Description: related to beta-N-acetylglucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
988	HG970333|CGC5	107697.76	7.4668

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:1264095-1267422(-)

Full Sequence      

MAPPGSASSSSSREGYSHANASHRYLRLKHAGPSRDEHCHHHQKRPKYHVTRPRRRPTIM
AHSDNSDLDPSWHDLDRAIGQILIMGWDGTEVTPQIRTLIEDHHLGSIILTAKNLKSAQQ
TAELVQELQTIAKNAGHLQPLLIALDQENGGVNSLFDEDYVCQFPSAMGVAATGRADLAY
EVTKATATEISACGVNLMLGPVLDVLNNARYQPLGVRATGDDPQEVSQYGLAALRGIRDA
GIASCGKHFPSYGNLNFLGSNLDVPIITQTLEELSISALVPFRNAVASGKLDAMFVGGCG
ISNPSMNVSHACLSEQVVDELLRDELGFNGVAISECLEMEALSHELGVQNGVIMAVEAGC
DLVLLCRAYDVQLEAIKGLKLGYDNGIVSKERIFTSLRRVLNLKSTCTSWEKALNPPGIS
LLSQLHPSHLALSLRAYDDSITIIRDKEKLIPLTASMHPGEELLLLTPLVKPLPASSLTK
KLLAAKDSQSQAEGPHEMWAHNDGRDRRAILSGEGVFREFGKSLARARNEKLLHTSYTAN
GVRPVHENLIHRASCIVIVTADANRNLYQAGFTKHVDMMCSMLRARGQKKQLIVVAVSSP
YDFAMDKSIGTYICTFDFTENALHALARTLVGEITPLGTLPGTLRKSKKVVKSRQHWLVE
EYSSGRDASGLNDLLRAVHRASAPDLQFLRATTAASFQLNNPSIAESHFVVRNSSTNALY
GFAATYYIHGVGIMGGVFVEPTKRDVSIGRSLHRRAIRSLLQRRGIKQVQIGSAFPGVFL
GIPVDVEVNTIKEWFANSGWDVQFPRRVSNMVIQDLANWSAPEGLSQSIQRAGISFDLIH
GLDNADGVLSHVRNHASPEVLELYRHALSETKLSGIVRAKDASGNLLGTVIVCKQHSHLE
TYYPSLKSRSEDISGILAPVVPSMPLATLTLQGLAFMGVRQARNHKATKVMLGSSVDDGT
ESLTAMGFETLQAFEEITNSPENFSSLA

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T09849-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	140	364	2.6e-48	0.9490740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.13e-67	79	459	7	356	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	8.57e-58	75	403	2	316	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	3.13e-35	89	380	10	294	beta-hexosaminidase; Provisional
178629	PLN03080	8.27e-08	164	643	114	587	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF76727.1|GH3	0.0	1	988	1	988
CZS80018.1|GH3	0.0	1	988	1	988
CEI60558.1|GH3	0.0	1	983	1	984
QPC58239.1|GH3	0.0	60	988	1	929
QPC69633.1|GH3	0.0	60	988	1	929

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	7.70e-91	74	896	8	773	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	4.76e-65	75	644	13	531	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.57e-39	75	641	44	614	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.12e-39	75	641	18	588	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	2.98e-39	75	641	48	618	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	8.07e-39	75	641	44	614	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q3SKU2|NAGZ_THIDA	7.14e-34	83	383	6	300	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1
sp|B4SRK3|NAGZ_STRM5	5.46e-32	82	382	1	296	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain R551-3) OX=391008 GN=nagZ PE=3 SV=1
sp|B2FPW9|NAGZ_STRMK	1.00e-31	82	382	1	296	Beta-hexosaminidase OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=nagZ PE=3 SV=1
sp|Q0A911|NAGZ_ALKEH	1.99e-30	83	367	6	284	Beta-hexosaminidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T09849-p1.