CAZyme Information: FGRAMPH1_01T09555-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T09555-p1
• CAZy Family: CE4
• CAZyme Description: choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
640		70517.32	4.6163

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:906663-908774(+)

Full Sequence      

MILHRIRFALAAALAVGSTAATKDDIYDYVIVGSGPGGGSLAANLAKEGHSVFLIEAGGD
NHTSLLQSFPLLARTAAETPGHSWQFFVNHYQDFEAARRDPKYTYIQTNGSYYVGLDPPE
GAKPAGLYYPRGSTLGGSAQVNAMNFIWSPDNEWDYIANLTGDETWGHEHMRRHLMNLEN
CTYVPEGTPGHGFDGYLVNDLSNATIQIREPNVANMFQQMFQQTEGIDVENTDEMVELFR
RDMNGADPDRYKDGSLYSTPSAIDPSTGARSGAGIYINEVIDAGHPLTVSFHSLATKVLL
KQSRHGEKPKAYGVEYMVGEGLYSADGRYDPEKTGEMRKVFAKHEVIVSGGAFNTPQILM
LSGIGPREELEAWDIPVVVDLPAVGSNLHDNYEVPVQMQAEENWYEPVEGSPCTGTYDDQ
DPCFVEWRDNAAGPYAARDSGYGALWRSSQSWDEDSDLMFLSGIGLAGLTGFYPGYSRGE
LSSIDPAYWMHAVVKMQTSNSAGTVRLNSSDPRIRPNINFNYFSESAERDLDAIAEGIAM
LRRAFDATGIPYKQLIPDPENERQEIKDMAFSHHASSTCTIGPDDGDSCVDSRFRVRGVD
KLRVVDASVFPRSPGAMPNGPTWTISRKAFETLLEDNHKK

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T09555-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	27	635	4.9e-93	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	3.20e-57	27	637	8	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	8.59e-56	27	629	6	527	choline dehydrogenase; Validated
398739	GMC_oxred_C	4.13e-31	500	629	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	6.15e-27	18	618	47	561	Protein HOTHEAD
366272	GMC_oxred_N	2.62e-17	127	393	19	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF76580.1|AA3	0.0	1	640	1	640
CZS79873.1|AA3	0.0	1	640	1	640
QPC58123.1|AA3	0.0	1	639	1	638
CEI60416.1|AA3	0.0	1	640	1	639
QGI90450.1|AA3	0.0	1	638	1	638

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	4.33e-33	27	629	41	593	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3FIM_B	1.25e-29	27	636	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5OC1_A	1.67e-29	27	636	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
7AV4_AAA	2.68e-26	18	633	75	636	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	8.80e-26	18	633	15	576	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4K4K7|BETA_PSEF5	1.32e-39	27	633	5	533	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=betA PE=3 SV=1
sp|Q3K5H3|BETA_PSEPF	1.32e-39	27	633	5	533	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=betA PE=3 SV=1
sp|Q48CM7|BETA_PSE14	1.34e-39	22	633	2	535	Oxygen-dependent choline dehydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) OX=264730 GN=betA PE=3 SV=1
sp|Q1C932|BETA_YERPA	1.80e-39	27	633	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=betA PE=3 SV=1
sp|Q1CFR7|BETA_YERPN	1.80e-39	27	633	3	531	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.065589	0.934380	CS pos: 20-21. Pr: 0.9039

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T09555-p1.