CAZyme Information: FGRAMPH1_01T09511-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T09511-p1
• CAZy Family: CE4
• CAZyme Description: related to SPR1-exo-1,3-beta-glucanase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
433		49188.86	6.2838

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:856078-857426(-)

Full Sequence      

MHFSQLASLALVGSATAWLPHERDLASFNQTARFEQLGKRFKPNLGSGITKIRGVNFGGW
LVCEKWLQEDTWANKLQCGNSLSEFDCMNDHYKGSNRETGNQRFEEHWKTWINPDTVQSV
HDVGLNTIRIPIGYWSYTAIVDKASEPFADGDRMLPYLDAVVKKAADLGIYVIMDLHGAP
GGQQEDVFTGQNNKPAGFYNDYNFGRAEKWLAWMTNRIHTNPAYSTVGMIEVLNEPVSRH
DGGNRYPAPGQDPGLIQKYYPAALKAVRDTESGLKVSNDKKLHVQFMSSKWDSGDARTQS
SIANDALTAFDDHNYIGFALNDNQNSNGDAYKLMHSACTDSRLVKGQDFMLTGEWSMTSN
YDWKDKEFFNKFFTAQQQLYEVPGMAGWVYWTWKTETNDPRWTYSYATYLKYIPTDAVGL
QNNVYRDVCAGYR

Enzyme Prediction     

EC	3.2.1.75:9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	98	404	2.3e-116	0.9866666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	7.47e-19	98	399	56	368	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	9.27e-09	107	270	15	157	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CZS79851.1|GH5_15	0.0	1	433	1	433
CEF76558.1|GH5_15	0.0	1	433	1	433
QPC69498.1|GH5_15	0.0	1	433	1	433
QPC58106.1|GH5_15	0.0	1	433	1	433
CEI60393.1|GH5_15	4.43e-306	1	433	1	433

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	6.67e-22	52	409	9	374	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	1.74e-21	52	409	14	379	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	2.25e-21	52	409	9	374	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	2.38e-21	52	409	15	380	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PC8_A	5.90e-21	52	409	15	380	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DGM6|EXGB_NEOFI	8.78e-82	5	416	4	389	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1
sp|Q5B6Q3|EXGB_EMENI	2.51e-80	15	416	14	399	Glucan endo-1,6-beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgB PE=2 SV=1
sp|B0XRX9|EXGB_ASPFC	6.82e-80	10	404	10	377	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgB PE=3 SV=1
sp|Q4X1N4|EXGB_ASPFU	7.56e-79	10	404	10	377	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgB PE=3 SV=1
sp|Q0C8Z0|EXGB_ASPTN	1.34e-78	6	416	9	393	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001574	0.998415	CS pos: 17-18. Pr: 0.9467

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T09511-p1.