CAZyme Information: FGRAMPH1_01T09329-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T09329-p1
• CAZy Family: CE4
• CAZyme Description: DUF1237 domain

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
519		58214.62	6.5060

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:647349-649325(+)

Full Sequence      

MLYSYARQLLLGALALQSADAASWKDYKPQSRTPSSCPDYVDYSQKPHEPLSSGKLKLPF
MRPSEECRTFKSPAVEKVIKDMKKRIKNPDLARLFENAFPSTLDTTVKYFDAKKNLAFIV
TGDITAQWLRDTGNQFAHLYKLLPQDENLKDLVKAIINTEARYISEYPYCGAFQPPPESG
LSPSVNDYAELVTVNPPVDNQTVFECKYELDSLAGFLKIARSYYNNTKDASFINDNFKSA
MTQILRVIDEQSQSTWAEDWSYVSYYNWTGNAGSLSPPVPNSGNGEPKLANGLVACSHRP
SDDLSVFNYITSDNAMMSVELDNVANVLDKAKSQTKLAKTLRSHAETIRQAVWNHTLTSN
GIFAYETNGYGGQYIMDDANVPSLVSLPYLGFLDRSDKTYQKTKSLLFSRANPYYAVGKT
FRGIGGPHANATNPWPMAHVSAIYGTDDDDEIKERLNIILENTSGLGLVHESVNIYNSTV
FTRPWFAWANSYFAEMVLDLAERKPGLIFKDNKPYVIGK

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T09329-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	88	498	3.7e-130	0.9975124378109452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399660	Glyco_hydro_125	0.0	88	498	1	416	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
226068	COG3538	2.09e-125	67	512	2	434	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF76467.1|GH125	0.0	1	519	1	519
CZS79761.1|GH125	0.0	1	519	1	519
QPC58042.1|GH125	0.0	1	519	1	519
QPC69443.1|GH125	0.0	1	519	1	517
CEI60302.1|GH125	0.0	1	518	1	517

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3P2C_A	4.76e-80	62	500	21	450	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
2P0V_A	2.03e-78	62	500	43	468	Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3ON6_A	2.89e-77	62	500	23	448	Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
6RQK_A	7.97e-67	75	499	12	421	Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13],6RQK_B Crystal structure of GH125 1,6-alpha-mannosidase from Clostridium perfringens in complex with mannoimidazole [Clostridium perfringens str. 13]
5M7I_A	4.30e-66	75	499	12	421	Crystal structure of GH125 1,6-alpha-mannosidase mutant from Clostridium perfringens in complex with 1,6-alpha-mannobiose [Clostridium perfringens str. 13],5M7Y_A Crystal structure of GH125 1,6-alpha-mannosidase mutant from Clostridium perfringens in complex with 1,6-alpha-mannotriose [Clostridium perfringens str. 13]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10449|MU157_SCHPO	3.44e-131	36	511	26	507	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000458	0.999526	CS pos: 21-22. Pr: 0.9722

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T09329-p1.