CAZyme Information: FGRAMPH1_01T06423-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T06423-p1
• CAZy Family: AA9
• CAZyme Description: glycosyltransferase family 32

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429		49039.17	7.9947

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970332:8611875-8613164(+)

Full Sequence      

MASGSRRNIPSNLRIPPPITVKWTVTNKSKSKMGTPLGSPTLVASTAKFRNRVPAQMQRC
IPLYICCVILLFIILNFDIFYSIPSPLTAFRTEKAPLVTRTRFSSFPQKIWQTWKVDPLN
FEDRDLLTSRTWVNKNPGMRYEVLTDDNELSFVEEHFGAGSQINRPDIVKFYKSINLHII
KADLLRYMIMYAQGGVYADIDVEALRPVHRFIPERYDERDIDLIVGVEIDQPEFSNHPIL
GKKSKSFCQWTIIAKPHQPVMLHLIEHIMAWLKDESKKQRVSLGDIELTFDQVISGTGPS
AFTGALLEQMNHHHKGGKVTWDLFHNIDESKVVGRVLVLNVEAFCAGQGHSDSGNHDSRG
ALVKHHYHASNWPSKHPRYSHPAYGQVEDCNWNAECVRLWDENVAEYEKLSEEEKQAKIE
QAKKPDIGI

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T06423-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	129	213	2e-18	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	9.92e-21	106	334	82	310	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.41e-11	123	214	2	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CZS78294.1|GT32	0.0	1	429	1	429
CEF75016.1|GT32	0.0	1	429	1	429
QPC68287.1|GT32	0.0	1	429	1	429
QPC77166.1|GT32	0.0	1	429	1	429
CEI66613.1|GT32	6.65e-315	1	429	1	429

PDB Hits     

FGRAMPH1_01T06423-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.88e-35	104	372	140	393	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|P47124|HOC1_YEAST	2.04e-30	106	352	130	370	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|Q5A4E3|OCH1_CANAL	2.20e-29	81	344	75	348	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	1.66e-19	107	270	97	284	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999766	0.000244

TMHMM  Annotations     

Start	End
60	82