CAZyme Information: FGRAMPH1_01T05459-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T05459-p1
• CAZy Family: AA7
• CAZyme Description: glycoside hydrolase family 16

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322	HG970332|CGC22	36431.36	6.1332

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970332:7338641-7339669(+)

Full Sequence      

MAWKDHLKRLKNEFQSLVGEPEAQNQNQNQNQNQQYYPPPPPPPQEQQQQPMGGGQNQSQ
QGHVYWQPQFRPDAPVTSEWDAKIGNGPDGWGNQELQHYTADQQNAFHTPDGKLVLRAIA
NNAESNHEKRYTSARLVSRQTLSRDQGVLTAWLTSPCATGIWPAFWLLPQEPFSWPTDGE
VDIAETWNGDLENHSCLHWGHHHEPDKHRVLGTKIPDMQYRPVRYDLAWLQPGGQAGQGR
MVWYIDGRPVMKGEIPAGTRPMRDMNILLNVAMGGNVCGGKTPSDGQYDMVVHSLYMGSE
PEHGGWHRFESDWAAAPMGNTY

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T05459-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	66	285	8.7e-42	0.9391304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185693	GH16_laminarinase_like	1.48e-30	72	276	8	212	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185691	GH16_Strep_laminarinase_like	4.72e-23	63	276	3	233	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
185683	Glyco_hydrolase_16	2.97e-11	70	292	3	204	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185690	GH16_fungal_Lam16A_glucanase	8.60e-09	100	198	37	130	fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Group of fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Lam16A belongs to the 'nonspecific' 1,3(4)-beta-glucanase subfamily, although beta-1,6 branching and beta-1,4 bonds specifically define where Lam16A hydrolyzes its substrates, like curdlan (beta-1,3-glucan), lichenin (beta-1,3-1,4-mixed linkage glucan), and laminarin (beta-1,6-branched-1,3-glucan).
225182	BglS	8.72e-05	77	287	56	253	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF74534.1|GH16	3.29e-229	1	322	1	322
QPC67869.1|GH16	9.42e-229	1	322	1	322
CZS77809.1|GH16	3.40e-227	1	322	1	324
QPC76738.1|GH16	3.51e-225	1	322	1	326
CEI66150.1|GH16	5.00e-215	1	322	1	313

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JH5_A	7.84e-25	60	276	2	208	Structure of Marine bacterial laminarinase [Aquimarina]
4CRQ_A	4.56e-24	60	276	1	207	Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CRQ_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S [Zobellia galactanivorans],4CTE_A Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans],4CTE_B Crystal structure of the catalytic domain of the modular laminarinase ZgLamC mutant E142S in complex with a thio-oligosaccharide [Zobellia galactanivorans]
6JHJ_A	5.64e-24	60	276	2	208	Structure of Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]
3ILN_A	7.75e-19	64	275	7	222	Chain A, Laminarinase [Rhodothermus marinus],3ILN_B Chain B, Laminarinase [Rhodothermus marinus]
3ATG_A	1.16e-18	62	275	3	214	endo-1,3-beta-glucanase from Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23903|E13B_NIACI	2.37e-20	63	297	424	676	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
sp|C1IE32|E13B_CRYAT	5.44e-18	66	281	24	244	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
sp|Q27082|CFGA_TACTR	6.77e-18	64	276	27	229	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
sp|P45798|GUB_RHOMR	7.74e-16	64	275	42	257	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
sp|O33680|EXSH_RHIME	8.04e-09	76	289	235	445	Endo-1,3-1,4-beta-glycanase ExsH OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exsH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T05459-p1.