CAZyme Information: FGRAMPH1_01T04441-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T04441-p1
• CAZy Family: AA7
• CAZyme Description: glycosyltransferase family 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
800	HG970332|CGC58	87143.33	7.1810

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970332:5998600-6001534(-)

Full Sequence      

MSNQKEKSAKQYDAMSDKSELDESLDVPPPYELHSSGTVLASSAAVNEHGSLDITFSSMA
PEEVNRLLPPQKPHQPESAAESSATPQQPCPRLTVVIQVVGSRGDVQPFIALGVALKRYG
HRVRLATHDTFADFVRSSGLEFYPIGGDPEDLMAYMVQNPGLIPSMQSLRGGDIGRKRVM
IREMLRGCWKSCVEPDPISSQAFVADAIIANPPSFAHVHCAEALGIPLHIMFTMPWTATR
AFPHPLANVQSQNMDPKASNYLSYGVVDLMTWQGLGDVINAWRAKDLELERLPAAVGPDI
VEIMKIPHTYCWSPALVPKPADWGDNIDISGFFLRDEPSYTPSSDLEQFLSNGSQPVYIG
FGSIVIEDPTEMTRIIKEACQRAGVRVIISRGWSKLGGTESSTDSVFYLGDCPHEWLFKR
VAAVVHHGGAGTTACGLINGRPTTIVPFFGDQPFWGGVVASNGAGPLPIAYRSLSVDNLS
EAIKFCLSPEARNSAEIIAAQMRQEKGVEKAVNSFHRHLPVAEMSCNLLEQRVARWQYSK
AKKTDSSPIRVSDEALQILLQSKKVKMGDFKLLRPKDYRIENQRWDPLTAGASSVLGTMT
DFTTSLGGTFIDPFKEMKRVKQDGSQTSVGAAAAVAAGKGMQGMTTAVVKGSLVDFPLAL
ADGLKNVPRLYGEEVRDHGPVTDWKSGGTVAAKNFGYGFYEGLTNIVTKPMKGAKEEGTM
GFMKGLGKGTVDIVTKPGSAMFGLLAYPAQGIYKSAKTYQRSNVERAMESGRAETLKVTQ
YSSPQGQNEQVVRRFQELNT

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	113	517	2.8e-58	0.981675392670157

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.61e-83	95	518	3	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	5.41e-48	92	517	1	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	5.75e-29	95	243	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	1.17e-07	104	511	7	382	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
227376	MRS6	1.01e-04	689	786	2346	2434	Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF74027.1|GT1	0.0	1	800	1	800
CZS77295.1|GT1	0.0	1	800	1	800
QPC76318.1|GT1	0.0	1	799	1	800
QPC67427.1|GT1	0.0	15	799	1	786
CEI65662.1|GT1	0.0	1	800	1	801

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	5.10e-81	100	554	27	473	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	6.29e-81	57	554	12	493	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	1.39e-35	93	505	1	385	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	5.77e-34	95	525	3	394	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	9.47e-31	93	502	1	383	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Z7|U80A2_ARATH	1.05e-137	91	525	191	616	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q9XIG1|U80B1_ARATH	8.40e-137	91	520	154	575	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q6C8M8|ATG26_YARLI	1.35e-84	85	522	990	1416	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
sp|Q54IL5|UGT52_DICDI	3.53e-79	66	520	1137	1610	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|A2QNQ5|ATG26_ASPNC	3.62e-79	88	523	892	1318	Sterol 3-beta-glucosyltransferase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=atg26 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T04441-p1.