CAZyme Information: FGRAMPH1_01T04385-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T04385-p1
• CAZy Family: AA7
• CAZyme Description: glycosyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		42106.75	6.0475

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970332:5940505-5941647(+)

Full Sequence      

MAPNIKTLSIPSATVQSHASNLLQLPDKTVLCTWFGGSQEGLPDICIWLSRLEPGSTSWS
TPQKVSSDENRSCQNPVLFRAPHNGDLWLLHTSQDAGNQDGAYILKRTSSDEGKTWSEAS
RLLPNATGIFIRQPIVVNSEGAWILPVFYCRTEPGHRWIGSDDISGVFYSQDNGATWKEK
QAPDSVGAVHMNIVPPASDQTTWVAVYRSRWADNVYRSTSKNGIDWEEPKATSLPNPNSG
ICAARLSSGHIALVFNRSSASADTLKRKGLYDDITPEDDKRPNQVTKTGKDAIWGTPRKT
LTLGVSQDEGLTWSERVLEDGDGFCGTNSSSGQENRELSYPSIYIERKGETDVAHVAYTW
HRQHIKYVQIEDVEGWVQSK

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T04385-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	21	320	1.6e-23	0.8187134502923976

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404074	BNR_2	7.59e-65	28	349	1	276	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
227036	COG4692	1.42e-61	10	379	26	378	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
271234	Sialidase_non-viral	1.76e-36	18	370	15	338	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	5.41e-04	9	122	191	299	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
405545	PSII_BNR	0.002	50	200	171	290	Photosynthesis system II assembly factor YCF48. YCF48 is one of several assembly factors of the photosynthesis system II. The photosynthesis system II occurs in Cyanobacteria that are Gram-negative bacteria performing oxygenic photosynthesis. One of the three membranes surrounding these bacteria is the inner thylakoid membrane (TM) system that is localized within the cell and houses the large pigment-protein complexes of the photosynthetic electron transfer chain, i.e. Photosystem (PS) II, PSI, the cytochrome b6f complex, and the ATP synthase. YCF48 is necessary for efficient assembly and repair of the PSII. YCF48 is found predominantly in the thykaloid membrane. It is a BNR repeat protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF73999.1|GH33	6.28e-295	1	380	1	380
CZS77267.1|GH33	2.10e-293	1	380	1	380
CEI65638.1|GH33	7.79e-280	1	380	1	380
QGI98506.1|GH33	1.42e-266	1	379	1	379
QGI67622.1|GH33	1.42e-266	1	379	1	379

PDB Hits     

FGRAMPH1_01T04385-p1 has no PDB hit.

Swiss-Prot Hits     

FGRAMPH1_01T04385-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000051	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T04385-p1.