CAZyme Information: FGRAMPH1_01T03929-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T03929-p1
• CAZy Family: AA6
• CAZyme Description: pectin lyase B precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375		39368.36	9.1127

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970332:5356352-5357479(-)

Full Sequence      

MPSLFKTLFAVAALLPSAFAALPTKAEGFASSTTGGGSAAAVYPKNAQELVSYLGDSQPR
RIMLDRTISFLGTEGTASETGCAPWGTGSQCQLAINQNGWCNNYQPNAPKVNVKYDKAGI
LGIKVGSNKSLIGVGNKGVIRGKGIRIVGAKNVIIQNVHITELNPQLVWGGDAITLDDTD
NVWIDHVTTSLIGRQHIVLGNKACNRVTISNSKIDGTTSWSASCNTYHYWGLYFAGSNDL
VTLKNNYIYRVSGRGPKVAGNTLLHAVNNFFHDVPDHAFEIDSGSALVEGNVFQNVKYPV
NSQGIQGQLFGVPNGGSACAAALGRNCQVNGFGSSGTLGGTSTGFLNNFKGKTIASASDY
NSAKSVMTSAGFGMA

Enzyme Prediction     

EC	4.2.2.10:25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	112	295	9.1e-86	0.9946524064171123

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.85e-51	110	297	1	190	Amb_all domain.
226384	PelB	3.42e-19	2	299	14	279	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	1.27e-14	123	293	30	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
404168	Beta_helix	0.003	140	289	21	152	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPC67353.1|PL1_4	3.81e-273	1	375	1	375
CZS77037.1|PL1_4	3.81e-273	1	375	1	375
CEF73771.1|PL1_4	3.81e-273	1	375	1	375
QPC76111.1|PL1_4	1.55e-272	1	375	1	375
CEI65430.1|PL1_4	1.94e-266	1	375	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	7.85e-149	26	357	7	341	Pectin Lyase B [Aspergillus niger]
1IDK_A	3.51e-140	26	373	7	357	Pectin Lyase A [Aspergillus niger]
1IDJ_A	4.98e-140	26	373	7	357	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
3VMV_A	1.43e-11	72	296	3	249	Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 [Bacillus sp. N16-5],3VMW_A Crystal structure of pectate lyase Bsp165PelA from Bacillus sp. N165 in complex with trigalacturonate [Bacillus sp. N16-5]
1AIR_A	7.19e-11	129	311	89	274	Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O88_A Chain A, Pectate Lyase C [Dickeya chrysanthemi],1O8D_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8E_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8F_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8G_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8H_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8I_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8J_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8K_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8L_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1O8M_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi],1PLU_A Chain A, Protein (pectate Lyase C) [Dickeya chrysanthemi],2PEC_A Chain A, PECTATE LYASE C [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WV10|PELA_ASPFU	8.71e-155	10	368	9	372	Probable pectin lyase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pelA PE=3 SV=1
sp|Q2TXM4|PELA_ASPOR	1.19e-154	26	373	26	377	Probable pectin lyase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelA PE=3 SV=1
sp|B0XT36|PELA_ASPFC	1.33e-153	5	373	3	376	Probable pectin lyase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pelA PE=3 SV=1
sp|Q4WIS6|PELB_ASPFU	1.33e-153	5	373	3	376	Probable pectin lyase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pelB PE=3 SV=1
sp|Q5BA61|PELB_EMENI	2.77e-153	11	369	11	372	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000381	0.999582	CS pos: 26-27. Pr: 0.5946

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T03929-p1.