CAZyme Information: FGRAMPH1_01T03095-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T03095-p1
• CAZy Family: PL4
• CAZyme Description: beta-glucosidase btge

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
614		65759.49	5.0535

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970332:4120827-4122729(-)

Full Sequence      

MKGGIAAAAVAAMATGAQAAYPHHRRAHELFRRGGEVCVPSCTTIWTTYYGEPTLVPNPP
SPPKPTAQAVTTHEAPKPKPTTAYEVPTYKAPKPVAPTTTKVVVPIPTPQEYKCPTPGTY
TFPATTMTVTESTTVCVGETTKVPAGTHTMGGVTTIVETATTVTCPYAKETEHEGVVTSV
IETTTYVCPSAGTYTIAPITKTCEEETVIVYPVPTSYVPGTYTAPEQVITVTETDFVYVC
PYSQSGVPATTKVPEAPKPQPPKETKPVYEAPKPSPETTEEAKPTKPVYDLPSIVPEIPK
PSKPVYSAPETPAYTEPAVETSEAPKPKPKPSPPKKPSTPGNLKGGNDHYGITYTPYESS
TGKCKSGDQVDKDIAALKGAGFQIIRSYSTDCDTLETVAPACKKYGIEMIVGVFVKASGC
TYETPEIKEQVDALAKWAQWDQVKLFTVGNEAIMNNFCSPQELADLIGVVKEKCSGYTGP
YTIAETLNIWQREDVKEAICGCVDVTGANIHPYFNSEVTPASAGEFVQGQLDLLADICKG
NDVINLECGWPSAGECNGTACPGKKEQAEAIKSIRKSCGDKTVFFSYEDDLWKEPGSCNC
ERSWGCKSAFIGGY

Enzyme Prediction     

EC	3.2.1.-:1

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.35e-50	351	610	47	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
223021	PHA03247	8.25e-06	71	317	2667	2947	large tegument protein UL36; Provisional
411474	fibronec_FbpA	2.86e-05	241	340	168	277	LPXTG-anchored fibronectin-binding protein FbpA. FbpA, a fibronectin-binding protein described in Streptococcus pyogenes, has a YSIRK-type (crosswall-targeting) signal peptide and a C-terminal LPXTG motif for covalent attachment to the cell wall. It is unrelated to the PavA-like protein from Streptococcus gordonii (see BlastRule NBR009716) that was given the identical name, so the phase LPXTG-anchored is added to the protein name for clarity.
236766	rne	4.25e-05	157	323	850	1037	ribonuclease E; Reviewed
223880	TonB	2.16e-04	248	324	54	127	Periplasmic protein TonB, links inner and outer membranes [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CZS76619.1|GH17	0.0	1	614	1	614
CEF73349.1|GH17	0.0	1	614	1	614
QPC67004.1|GH17	0.0	1	614	1	614
QPC75749.1|GH17	0.0	1	614	1	614
CEI65025.1|GH17	0.0	1	614	1	615

PDB Hits     

FGRAMPH1_01T03095-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y9Q9|BTGE_ASPFC	3.56e-99	1	610	1	564	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2
sp|Q4WC60|BTGE_ASPFU	3.56e-99	1	610	1	564	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgE PE=3 SV=2
sp|Q0CEX9|BTGE_ASPTN	1.35e-96	1	610	1	558	Probable beta-glucosidase btgE OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgE PE=3 SV=1
sp|A1DBG6|BTGE_NEOFI	1.38e-89	144	610	147	551	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1
sp|B8MXP5|BTGE_ASPFN	1.82e-89	144	610	195	601	Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000432	0.999542	CS pos: 19-20. Pr: 0.9741

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T03095-p1.