CAZyme Information: FGRAMPH1_01T01933-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T01933-p1
• CAZy Family: AA3
• CAZyme Description: beta-glucosidase b

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
834		90714.55	5.1506

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970332:2504427-2507047(-)

Full Sequence      

MSSVDIQSILSSLTLEEKISLLAGKDLWETVPIPSKGVPNVKTSDGPNGARGAAFAGGTS
AACFPAACLMASTFDVDLAKRIGTALAEETHSKGARCLLAPTMCLHRHPLGGRNFESFSE
DPLLTGKMAARVVEGLQEQGVSATIKHFAANEQETERLTVDETISERALRELYLRPFEIA
VKEANPWAIMTSYNKVNGHHADSNQFLLKQVLRGDWGWDGLVMSDWGGVNSTAESLEAGL
DLEMPGPTRWRNTEDVIAAIKAGKTSEETINERATHVLKFLERLNCFKDPTIPDERAINN
PKHQALIREAGSKGIVLLKNQDNILPLSKEKVKGKKIALLGHAKIGLAHGGGSASVNAHY
RITPWDALHEALGDSVEFSYAKGAHTFRMLPPISENVVDLDGNPGFTYKMFEPGNPEPIE
VRSGHASSEVSLLSGFGFSNKDITLEGTFTAQETAKYYFTVSGLGPSKLAIDDKVVFEQK
ENCRDAMGFLFGGVNPPEFKVSLEAGRKYKLAMYTSPPVPKEGVDIGILEGRCGLRVGYM
SEAEHDRDLLSEAIDVAKDADYAIVFTGHEPFWETEGQDQVSFNLPKDGSQDRLIAKVAE
ANPNTIVVNSTGVAIAMPWLDEIQGFVQTWFPGQECGNSIADVLTGAQTPEGHLTCTFPK
RIEDCPAYGNFPGKHVDGELRVTYSEGVFIGYRYFDCLSADKVNFPFGFGLSYTTFDYSD
LEVKESGDDYIASVKVSNTGKVTGAIAVQVYVGAAETRKGDPMKQLAAFAKVTLKPGEST
KVDVPVRTRDFAFFDESVQKWVVNGGEYKFMIGRSAGDIALESKVTVGDKSFKP

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	34	245	1.5e-67	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	4.61e-76	64	813	120	751	beta-glucosidase BglX.
224389	BglX	6.28e-69	25	346	47	367	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	6.63e-49	315	692	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.86e-46	64	278	88	314	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	4.21e-44	7	813	54	769	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF72767.1|GH3	0.0	1	834	1	834
CZS76034.1|GH3	0.0	1	834	1	834
QPC66486.1|GH3	0.0	1	834	1	839
QPC75250.1|GH3	0.0	1	834	1	834
CEI64461.1|GH3	0.0	1	834	1	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.93e-180	1	819	1	828	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.16e-175	2	819	2	828	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	6.23e-136	3	827	2	668	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	2.16e-124	6	834	4	721	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	3.25e-123	6	834	4	721	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	0.0	6	834	11	845	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|A1DFA8|BGLI_NEOFI	2.51e-197	1	832	1	834	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q0CAF5|BGLI_ASPTN	3.65e-197	1	823	1	827	Probable beta-glucosidase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	2.89e-196	1	827	1	830	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	7.90e-196	1	832	1	834	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999936	0.000106

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T01933-p1.