CAZyme Information: FFUJ_14876-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_14876-t31_1-p1
• CAZy Family: GT71
• CAZyme Description: related to bromodomain protein BDF1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
609	HF679026|CGC16	62598.94	4.0914

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679026:3297759-3299588(+)

Full Sequence      

MRLQSIAAILAAAATASAQSVSGKAYGFAAGVTGGEGEAVTPSSAEELATLLADDTPRVI
YLDKEFDFTGDVKTGAGCDRKSCSASNGGQLYLGDLSCGGDDNVAVSSITYDAAGPEPLP
VGSNKSIIGNGKAVLKGKGLSIKKGSKNVIVQGIEFTDINPGVVWGGDALELKGLNDGVW
IDHCKFSKVGRMFIVSHYDGSRLTISNSEFDGVTDTSASCNGNHYWTMMFYGEGDQVTLD
RNHFHDVAGRAPKLGEPGTNGYFHATNNYFQNMKGHAFDAYQGANAIIEGNVFDGVDTPI
TKEAASVSTLFVADESGASACQSALGRACVPNSATSSGDLPSLKGESGLNAVAKNKDNII
TPVSASEVTALVLGSVGPANVGSGSNSGSNSGSGSGSGSESAPSQSPESGNEATETTPAT
PETTPESTPETAPETTPEAVNEQEALPDCPEETENEPVANAEVKPIASDDCEEETDATPA
KTEEKPVTTGDCDDEIEAAADTSSETEQKPTAPATPSKQVSSSSDDCDEEPKAEVKPVAT
GDCDEEETSAAATDSSSSAGSSTAQMYGQCGGKNWTGATTCPSGTSCKKMNDYYSQCIGS
NSRVRRYIQ

Enzyme Prediction     

No EC number prediction in FFUJ_14876-t31_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	109	294	8.2e-76	0.983957219251337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.46e-44	108	297	3	190	Amb_all domain.
226384	PelB	8.91e-18	27	300	36	280	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	9.63e-17	118	293	29	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
395595	CBM_1	8.13e-14	566	594	1	29	Fungal cellulose binding domain.
197593	fCBD	7.25e-13	567	598	3	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT67826.1|CBM1|PL1_4	0.0	1	609	1	609
QGI94784.1|CBM1|PL1_4	0.0	1	609	1	609
QGI63902.1|CBM1|PL1_4	0.0	1	609	1	609
QKD61651.1|CBM1|PL1_4	0.0	1	609	1	548
QGI81172.1|PL1_4	2.97e-267	1	577	1	559

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	1.17e-65	21	340	3	322	Pectin Lyase B [Aspergillus niger]
1IDK_A	5.04e-62	21	338	3	319	Pectin Lyase A [Aspergillus niger]
1IDJ_A	1.92e-61	21	332	3	313	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
5X39_A	7.94e-09	563	598	1	36	Chain A, Exoglucanase 1 [Trichoderma reesei]
6MVI_A	8.89e-09	563	597	258	292	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	1.20e-94	14	384	16	383	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q0CFF7|PELF1_ASPTN	7.91e-88	1	377	1	384	Probable pectin lyase F-1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-1 PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	3.33e-84	14	386	16	387	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|B8N316|PELF_ASPFN	3.33e-84	14	386	16	387	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	4.68e-84	7	385	10	387	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000274	0.999666	CS pos: 18-19. Pr: 0.9759

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_14876-t31_1-p1.