CAZyme Information: FFUJ_14851-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_14851-t31_1-p1
• CAZy Family: GT69
• CAZyme Description: related to putative alpha-L-fucosidase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
608	HF679026|CGC18	66973.79	5.1234

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679026:3231515-3233341(+)

Full Sequence      

MTLSTKLTAIAAAAGSLFPINAAAQASGPYEATWESTDKHNASPEWFRDAKFGVYWHWGA
FTTPQYASEWYPRNMYEPGSDQRKHHTETYGPPEEWGYANFINGADDLKGNFVQFKPVLS
SKGGEFDPEAIINAVKASGAKFAGPVGEHHDGYSMWDSKVNEWNSVKRGPKLDLVKLWAG
LVRKNGMKLVVAMHQAYNYNGFYEWAPKTNDTSLKKLLGQLSREESDQLWFDKHREMLDH
VQPDIIWNDFSLDSPGYCADFDGPCAVAEKKRLEFLAYYFNRAVEWDKEVVTTHKHFDVG
FRDTSTVSDYERGGPANITRPYWLTDDAISASSWSYTVGIKYYSSKAMVHSLLDRISKNG
NMLLNISPTAVGVLPDEQLKVLQDIGDFLGRYGESVFSTRAWDIYGEGPNQVTGGSFTAP
LQGNSSDVRFTRNKDANVLYATVLGWPDDKHVSIASLGSDALVDLKSLKSIELLGDKAGE
YEQVSDWKQTKDALEISLPAQPAESLAYVLKLTFDGGIPVPQPKIGASVFSATSASGPGV
SLGLGNFNEEFLTEAGLKPDAIRFIRVSSGTKLTVYSTGDLSGDSKELDAGEHKVEEGSV
GSITISKA

Enzyme Prediction     

EC	3.2.1.51:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	21	397	4.4e-86	0.9421965317919075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214829	Alpha_L_fucos	2.39e-123	24	457	1	384	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
395889	Alpha_L_fucos	1.18e-120	25	394	1	333	Alpha-L-fucosidase.
226195	AfuC	1.57e-53	57	451	1	374	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
407025	Fucosidase_C	5.94e-11	427	513	8	90	Alpha-L-fucosidase C-terminal domain. The C-terminal domain of Structure 1hl8 is constructed of eight anti-parallel-strands packed into two-sheets of five and three strands, respectively, forming a two-layer-sandwich containing a Greek key motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT67811.1|GH29	0.0	1	608	1	608
QGI94762.1|GH29	0.0	1	608	1	608
QGI81150.1|GH29	0.0	1	608	1	608
QGI63880.1|GH29	0.0	1	608	1	602
ENH64923.1|GH29	0.0	1	608	1	608

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4NI3_A	0.0	24	607	1	584	Chain A, Alpha-fucosidase GH29 [Fusarium graminearum],4NI3_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum],4PSP_A Chain A, Alpha-fucosidase GH29 [Fusarium graminearum],4PSP_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum],4PSR_A Chain A, Alpha-fucosidase GH29 [Fusarium graminearum],4PSR_B Chain B, Alpha-fucosidase GH29 [Fusarium graminearum]
7LJJ_A	2.84e-84	30	516	43	512	Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LK7_A Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]
7LNP_A	1.53e-83	30	516	43	512	Chain A, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_C Chain C, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_D Chain D, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135],7LNP_E Chain E, Exo-alpha-L-galactosidase [Phocaeicola plebeius DSM 17135]
1HL8_A	3.43e-43	30	461	8	405	Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL8_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase [Thermotoga maritima MSB8],1HL9_A Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8],1HL9_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With A Mechanism Based Inhibitor [Thermotoga maritima MSB8]
1ODU_A	4.71e-43	30	461	8	405	Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8],1ODU_B Crystal Structure Of Thermotoga Maritima Alpha-Fucosidase In Complex With Fucose [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17164|FUCO_RAT	1.12e-33	15	513	14	459	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1
sp|Q99KR8|FUCO2_MOUSE	1.10e-31	30	447	28	397	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1
sp|Q9VTJ4|FUCO_DROME	1.23e-31	24	460	25	421	Putative alpha-L-fucosidase OS=Drosophila melanogaster OX=7227 GN=Fuca PE=2 SV=2
sp|Q5RFI5|FUCO2_PONAB	1.31e-30	30	447	32	401	Plasma alpha-L-fucosidase OS=Pongo abelii OX=9601 GN=FUCA2 PE=2 SV=1
sp|Q99LJ1|FUCO_MOUSE	9.25e-30	34	513	27	449	Tissue alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000447	0.999521	CS pos: 24-25. Pr: 0.9693

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_14851-t31_1-p1.