CAZyme Information: FFUJ_14071-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_14071-t31_1-p1
• CAZy Family: PL1
• CAZyme Description: related to chitin synthase/hyaluronan synthase (glycosyltransferases)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
596		67188.86	7.6138

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679030:41737-43632(+)

Full Sequence      

MGTVESIDSRTQMAFTNVSQGRHLSILKQLLNFTGCLMIIPAFYLATIQTLYPMTIDILF
GIILTECNRFANERRRISFYSTFQRENNLKRQNLGFMMKETVTKLDCLSAVVGYREDPAL
FTRALESYKAAHGQAFMLVGIDGSDAEDGDMVDVFEKVYPSQSRIIHIKEPLGNIAEQLY
NKHLAIQHEKGREINESESNKAVIQQCMSIARVILDQQGCLIDEPDGIRHICLVQQHMHK
KGIMFTTFIFSLVIAEMLGIEFMWSSDSDTIVLEDTLERTISTIAGDSTIGGASSGLTVH
NGDDTVVTRLAATVYWAELYLTRSTPACTATSDCQSGPCTAFRLSALSSILMPWYMQKVF
GKRMIVNEDRHLTTNLLVRGWGVVFASDVLTATETPTTVTRWLRQQVRWARATHIESLLI
PRVYGMSHPMAFFAAARREFGPLVVAVAVLSYFLTSHKLLYFSYPDLFLRIGITTIYNIL
RNPDRLRLALCWYVVPGMFFYNIPLPAIHIWSLVTMTADTWGTAMRASTEISKKDSSRKK
WFETGFFVVWMGIVGGTVARWLANEFGLNQGQTLVSMLCGIWLASLCSWKATIESQ

Enzyme Prediction     

No EC number prediction in FFUJ_14071-t31_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133056	GT2_HAS	1.98e-16	267	413	85	232	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
224136	BcsA	1.71e-08	267	477	145	355	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	9.26e-05	267	350	86	169	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
404513	Glyco_trans_2_3	7.42e-04	267	469	6	193	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
404520	Glyco_tranf_2_3	0.007	267	412	95	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT71936.1|GT2	0.0	1	596	1	596
QGI84817.1|GT2	0.0	1	596	1	590
QGI67591.1|GT2	0.0	1	596	1	590
QGI98473.1|GT2	0.0	1	596	1	590
UKZ95583.1|GT2	1.10e-236	18	593	14	603

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SP7_A	1.39e-20	111	412	89	346	Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]
7SP6_A	5.75e-20	111	412	89	346	Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP8_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SP9_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2],7SPA_A Chain A, Hyaluronan synthase [Paramecium bursaria Chlorella virus CZ-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q61647|HYAS1_MOUSE	6.00e-23	111	453	105	428	Hyaluronan synthase 1 OS=Mus musculus OX=10090 GN=Has1 PE=1 SV=1
sp|Q92839|HYAS1_HUMAN	2.42e-21	111	453	101	423	Hyaluronan synthase 1 OS=Homo sapiens OX=9606 GN=HAS1 PE=1 SV=2
sp|P04341|NODC_RHIME	1.79e-19	267	451	140	323	N-acetylglucosaminyltransferase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=nodC PE=3 SV=1
sp|P72334|NODC_RHIS3	3.89e-18	267	451	140	323	N-acetylglucosaminyltransferase OS=Rhizobium sp. (strain N33) OX=103798 GN=nodC PE=3 SV=1
sp|P17862|NODC_RHILO	7.72e-18	267	451	140	323	N-acetylglucosaminyltransferase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=nodC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999970	0.000032

TMHMM  Annotations     

Start	End
30	52
440	462
489	511
541	563