CAZyme Information: FFUJ_13687-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_13687-t31_1-p1
• CAZy Family: GT20
• CAZyme Description: related to glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348	HF679026|CGC10	36873.24	4.7139

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679026:2216232-2217379(+)

Full Sequence      

MSMKRFFTSAVAMAAVVAAVPVARPLEKREPVTTITLTSASTYTATIAPVTPATPTGTAT
YPEPTAPISGSGGSSSGSKLPGVAYAPYRGDHQCKSKDEIQHDITQLAADFSVLRIYGTD
CDQVANVYSCAKGSGMKLFLGIWNIDDVQTEAKTIISAIDDWDVVDTISVGNELVNNGAA
TPSKVIAAVKQAREILRAAGYQGPVVTVDTFIAANANPELCNESDYCAINAHAFFDANTS
ADEAGQWLSNTVEDLRSKISGDKRIVICETGWPTKGNSNGKAVPGTSQQKAALDSIKQAF
SSHMGDLILFSAFNDPWKKAEAATFMAEQWWGIEGQDSVSNKDPSSSN

Enzyme Prediction     

No EC number prediction in FFUJ_13687-t31_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	89	333	1.1e-24	0.932475884244373

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	3.07e-74	82	333	47	300	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.67e-07	107	333	33	296	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI63520.1|GH17	1.90e-232	1	348	1	348
QGI80797.1|GH17	1.90e-232	1	348	1	348
QGI94402.1|GH17	1.90e-232	1	348	1	348
CCT67472.1|GH17	1.90e-232	1	348	1	348
QKD49574.1|GH17	1.77e-222	1	348	1	371

PDB Hits     

FFUJ_13687-t31_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53334|SCW4_YEAST	2.41e-75	74	333	127	382	Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW4 PE=1 SV=1
sp|Q04951|SCW10_YEAST	9.17e-73	75	337	133	389	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1
sp|Q59XX2|MP65_CANAL	5.31e-72	71	333	118	375	Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MP65 PE=1 SV=3
sp|Q0CEX9|BTGE_ASPTN	1.18e-42	75	336	297	557	Probable beta-glucosidase btgE OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgE PE=3 SV=1
sp|B0Y9Q9|BTGE_ASPFC	2.39e-41	82	332	310	559	Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000269	0.999696	CS pos: 29-30. Pr: 0.9699

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_13687-t31_1-p1.