CAZyme Information: FFUJ_12924-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_12924-t31_1-p1
• CAZy Family: PL9
• CAZyme Description: uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408		45052.34	7.1876

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679030:3190479-3191858(+)

Full Sequence      

MRVSTISAVFSGLAVSAIAQSDLDGAVWKALLAEPQSKRGFSDMPRNRPVKRQSGWNPPA
DLKAPLQEVWEHYEKTYDGGLDANVNTGFHQIMANKGYLNICVRWDSSTTVTEAERTKIA
SAYNAQYQKWFKWLYGYNGFPYDEVKVNIVAYAVKDKSQLQGSTAGYEVYTELDADGVPM
CPVACARDAHLDGDYSGCKAGADRHYDHSLWLKDGLEGGFGHNWGQEVGREYFMNNLDSD
NIHILLHEMGHTFALDDFYDWTPTGITKFIMLAGASMEITDFDGWMYRNWWYYLSQKNNW
GSGKSSTDIAPVSSESKPTTKTAASATKTSTPKPSTTTKAVITKPVSTKKATATKAPVTQ
VHSVETTSSAEVAPWGQCGGINWTGSKKCASGAKCTKRNDYYSQCVAN

Enzyme Prediction     

No EC number prediction in FFUJ_12924-t31_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
197593	fCBD	7.50e-13	373	406	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	1.03e-12	374	402	1	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT73102.1|CBM1	6.06e-289	1	408	1	408
QGI99522.1|CBM1	1.48e-284	1	408	1	406
QGI85823.1|CBM1	1.48e-284	1	408	1	406
QGI68632.1|CBM1	1.48e-284	1	408	1	406
QKD62209.1|CBM1	1.74e-258	1	408	1	407

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BMF_A	1.94e-08	375	406	7	38	Chain A, ENDOGLUCANASE EG-1 [Trichoderma reesei]
6Q8M_A	2.44e-08	367	406	367	406	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
6RV8_A	2.57e-06	370	406	3	39	Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor covalent complex with the aldouronic acid UXXR [Cerrena unicolor],6RV8_B Crystal Structure of Glucuronoyl Esterase from Cerrena unicolor covalent complex with the aldouronic acid UXXR [Cerrena unicolor]
1CBH_A	9.90e-06	375	406	5	36	Chain A, C-TERMINAL DOMAIN OF CELLOBIOHYDROLASE I [Trichoderma reesei],2CBH_A Chain A, C-TERMINAL DOMAIN OF CELLOBIOHYDROLASE I [Trichoderma reesei],2MWJ_A Chain A, Exoglucanase 1 [Trichoderma reesei],2MWK_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X34_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X35_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X36_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X37_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X38_A Chain A, Exoglucanase 1 [Trichoderma reesei]
5X39_A	9.90e-06	375	406	5	36	Chain A, Exoglucanase 1 [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P49075|GUX3_AGABI	7.66e-08	370	408	20	58	Exoglucanase 3 OS=Agaricus bisporus OX=5341 GN=cel3 PE=1 SV=1
sp|G4MPQ7|XYN6_MAGO7	3.67e-07	371	406	18	53	Endo-1,4-beta-xylanase 6 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=XYL6 PE=3 SV=1
sp|Q8NJ73|XYN6_MAGGR	3.67e-07	371	406	18	53	Endo-1,4-beta-xylanase 6 OS=Magnaporthe grisea OX=148305 GN=XYL6 PE=1 SV=1
sp|P0CT87|GCE1_PHACR	4.44e-07	369	406	19	56	4-O-methyl-glucuronoyl methylesterase 1 OS=Phanerochaete chrysosporium (strain RP-78 / ATCC MYA-4764 / FGSC 9002) OX=273507 GN=e_gw1.18.61.1 PE=1 SV=1
sp|P46239|GUNF_FUSOX	4.94e-07	370	406	17	53	Putative endoglucanase type F OS=Fusarium oxysporum OX=5507 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.510904	0.489098

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_12924-t31_1-p1.