CAZyme Information: FFUJ_12899-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_12899-t31_1-p1
• CAZy Family: GT15
• CAZyme Description: uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
560	HF679030|CGC21	59254.42	8.1913

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679030:3123378-3125060(+)

Full Sequence      

MLFSLVLPTLALQASLALGDASVTVNTNKKLQVIDGFGVSEAYGHAKQFQNLGPGPQKQG
LDLLFNTTTGAGLSIIRNKIGCDASNSITSTNTDNPEKQPVFHFNGDDDGQVWFSKQAMS
YGVDTIYANAWSAPVYMKSATSMGRLCGTTGVSCSSGDWRQRYVEMIAQYLSYYKEAGIP
VSHVGFLNEGDGSDFMLSTAEQAADVIPLLHSALQSKGLGDIKMTCCDNIGWRSQMDYTA
KLAELDVEKYLSVITSHEYSSSPDQPMNTTLLTWMSEGAANDQAFATAWYVNGGSNEGFT
WAVKIAQGIVNADLSAYIYWEGVETNNKGSLSHVVDTDGTKFTVSSILWAIAHWSRHIRP
GAHRLSTSGVVQDTIVGAFENVDGSVVMVLTNSGAAAQTVDLGVSGSTFATAQAFTSDAE
AQMVDTKVTVSGGNVKVTVPAHGVVTVKLTSAKSSKPVSTAVSSQSAPTPTSGKHSVVSQ
KHSSTTLSIVKAPTSTHTASVVESAKAVQYPAPHVTTKGSAKSVPAKGAKKSATKKGSRA
HGASHHRCRHGSHRRGHCTK

Enzyme Prediction     

No EC number prediction in FFUJ_12899-t31_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	21	447	6.5e-167	0.9909706546275395

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227807	XynC	1.46e-19	3	446	16	425	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
396577	Glyco_hydro_59	6.23e-11	54	356	20	293	Glycosyl hydrolase family 59.
307945	Glyco_hydro_30	1.68e-08	34	263	1	240	Glycosyl hydrolase family 30 TIM-barrel domain.
405300	Glyco_hydr_30_2	2.58e-05	22	327	3	360	O-Glycosyl hydrolase family 30.
407314	Glyco_hydro_30C	1.15e-04	361	447	1	63	Glycosyl hydrolase family 30 beta sandwich domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT73001.1|GH30_7	0.0	1	560	1	560
QGI85808.1|GH30_7	0.0	1	560	1	560
QGI99497.1|GH30_7	0.0	1	560	1	560
QGI68607.1|GH30_7	0.0	1	560	1	560
QKD62186.1|GH30_7	0.0	1	560	1	555

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M5Z_A	2.34e-108	11	450	14	454	Chain A, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7O0E_A	5.91e-91	22	449	4	447	Chain A, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	1.08e-89	22	449	11	454	Chain AAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6IUJ_A	7.94e-78	20	403	21	424	Chain A, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]
6KRL_A	1.40e-75	20	403	92	495	Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris [Saccharomyces uvarum],6KRN_A Crystal structure of GH30 xylanase B from Talaromyces cellulolyticus expressed by Pichia pastoris in complex with aldotriuronic acid [Saccharomyces uvarum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2Q1N4|XY30A_MYCTT	8.03e-91	22	449	28	471	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1
sp|O16580|GLCM1_CAEEL	9.72e-09	19	399	83	488	Putative glucosylceramidase 1 OS=Caenorhabditis elegans OX=6239 GN=gba-1 PE=1 SV=2
sp|O16581|GLCM2_CAEEL	3.88e-08	24	392	88	479	Putative glucosylceramidase 2 OS=Caenorhabditis elegans OX=6239 GN=gba-2 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000216	0.999766	CS pos: 19-20. Pr: 0.7850

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_12899-t31_1-p1.