CAZyme Information: FFUJ_12865-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_12865-t31_1-p1
• CAZy Family: GT1
• CAZyme Description: probable feruloyl esterase B precursor (subclass of the carboxylic acid esterases)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297	HF679030|CGC3	32077.33	8.4312

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679030:3036914-3037859(-)

Full Sequence      

MLGLPSPRKLLAQLSLGASLVAAQLQTINNFGNTYGTQLIMQAYIPSNLPSSPAVMLALH
ACGGNGPGYFQQTKYKSLADQKGVILIFPSSQKDFNCWDVASTKTLKHDGQGDSQVLVSM
VDYIINTYRADRNKVYVTGTSSGCMMTNVLAATYPDRFAAATCYSGVAAGCMAGSPGSSP
ISSDRVCSDGKIIKTGQQWADQVKSMYPGYSGAYPRFKTWHGTADNLVYYRNLLEQIKEW
STIQGVSFSRNETNTPQSGYTTMIYGDGTKFVAVSAAGVGHVVPTHEDLDFKWFGLS

Enzyme Prediction     

No EC number prediction in FFUJ_12865-t31_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	39	201	1.9e-25	0.6475770925110133

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	9.16e-38	41	255	1	209	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	2.12e-23	44	284	52	277	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	5.44e-18	44	173	6	137	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
226584	COG4099	2.34e-08	36	166	171	302	Predicted peptidase [General function prediction only].
395257	Peptidase_S9	2.97e-06	107	168	38	99	Prolyl oligopeptidase family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT72967.1|CE1	2.21e-219	1	297	1	297
QGI85778.1|CE1	2.21e-219	1	297	1	297
QGI99467.1|CE1	2.21e-219	1	297	1	297
QGI68577.1|CE1	2.21e-219	1	297	1	297
QKD62144.1|CE1	2.00e-206	1	297	1	297

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	7.06e-82	22	297	1	275	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9HE18|FAEB_TALFU	7.39e-102	21	297	17	292	Feruloyl esterase B OS=Talaromyces funiculosus OX=28572 GN=FAEB PE=1 SV=1
sp|B8M9H9|FAEB_TALSN	2.99e-97	22	297	18	292	Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) OX=441959 GN=faeB PE=1 SV=1
sp|Q9HGR3|FAEB_NEUCR	3.46e-88	7	296	3	290	Feruloyl esterase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=fae-1 PE=2 SV=2
sp|Q96W96|AXE1_ASPFI	2.20e-81	22	297	29	303	Acetylxylan esterase A OS=Aspergillus ficuum OX=5058 GN=axeA PE=1 SV=1
sp|Q92194|AXE1_ASPAW	9.11e-81	22	297	30	304	Acetylxylan esterase A OS=Aspergillus awamori OX=105351 GN=axeA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.606491	0.393498

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_12865-t31_1-p1.