CAZyme Information: FFUJ_11632-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_11632-t31_1-p1
• CAZy Family: GH55
• CAZyme Description: probable pectinesterase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329	HF679033|CGC23	34911.81	9.1952

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679033:1129585-1130671(+)

Full Sequence      

MKFLTTLSFVTAAFAASRTTAPSGCITVKKSPGSGQFGTVQAAVDSLSTTASGKQCIFID
QGTYNEQVLVPSRSAQLSIYGYTTDTSGYSGNKVTITAKKSQADGLNNDGTATLRVKAAN
FKLYNVNVANTYGQGSQAVALSAYADSGYYGVALTGFQDTLLAQQGYQLYSKCLIQGATD
FIFGQTASAWFEKIDLRVVAASVGYITANGRDSDSNMSYYVFNNCNIAAAAGNAVANGAY
YLGRPWRQYARVVFQKTSMSSVINSKGWSIWNTGEENTAHVLFGEYGNTGTGSQGQRASF
ATKLSNAVSISTVLSGNYASKGFYDASYM

Enzyme Prediction     

No EC number prediction in FFUJ_11632-t31_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	27	307	8.4e-78	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	6.42e-43	15	307	2	275	putative pectinesterase
178113	PLN02497	4.03e-41	26	318	34	325	probable pectinesterase
395871	Pectinesterase	1.30e-40	26	301	2	275	Pectinesterase.
215357	PLN02665	6.49e-40	12	307	62	343	pectinesterase family protein
215367	PLN02682	6.59e-40	15	305	60	348	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI88211.1|CE8	3.72e-234	1	329	1	329
QGJ01763.1|CE8	3.72e-234	1	329	1	329
CCT75603.1|CE8	3.72e-234	1	329	1	329
QGI70873.1|CE8	3.72e-234	1	329	1	329
QKD62636.1|CE8	9.80e-230	1	329	1	329

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	4.34e-73	17	328	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	4.34e-73	17	328	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	7.85e-29	33	292	15	272	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	2.72e-26	33	292	11	268	Chain A, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	2.00e-11	28	283	8	294	Chain A, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	1.90e-105	9	328	11	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	7.66e-105	2	329	4	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|B0Y9F9|PMEA_ASPFC	3.32e-75	17	328	27	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	3.32e-75	17	328	27	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	5.29e-74	17	328	27	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000263	0.999724	CS pos: 15-16. Pr: 0.9782

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_11632-t31_1-p1.