CAZyme Information: FFUJ_11325-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_11325-t31_1-p1
• CAZy Family: GH5
• CAZyme Description: related to SUR1-required for mannosylation of sphingolipids

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358	HF679033|CGC10	41499.82	7.8317

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679033:318523-319599(-)

Full Sequence      

MAFQNIIQHLRARFGKYERLYDEEHIELESPPHKRCVPKRFGFPRFRKLTVYLILINLII
LGLLIHSIRPLITLLIRNNELFAINFSVDHAAQPDAFQRPDGKKIPRILHQTAPNSSIPE
IWAASQQSCQKAYSDFEYKLWTDEGAREFLKEEFPWYLDTWDNYPFPIQRADAIRYFVLY
HFGGIYMDMDTYCNSSFPVDQIESLPGKEHALFKSTLPTGITNDFLIATARHPAFASAVS
RLASFHQTTRLWARLQPYAAIMLSTGPLFLTLAVQQYLLGQPILPSPNINIIDPAMVDYY
MTDFETATWHQSDAQVLKWLGDRPWTWFSLGIIGVTAGIYTFNCVLSRTFTTFYRKLL

Enzyme Prediction     

No EC number prediction in FFUJ_11325-t31_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	122	197	1.3e-23	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.80e-47	96	328	73	298	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.30e-21	119	199	1	85	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT75307.1|GT32	1.95e-271	1	358	1	358
QGJ01497.1|GT32	9.92e-269	1	354	1	354
QGI70607.1|GT32	9.92e-269	1	354	1	354
QGI87952.1|GT32	4.19e-262	1	354	1	349
QKD62321.1|GT32	4.99e-249	1	358	1	358

PDB Hits     

FFUJ_11325-t31_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	7.76e-54	47	351	2	297	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	1.01e-47	53	320	8	270	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	2.37e-43	105	319	82	291	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	6.27e-42	81	314	29	259	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	2.22e-39	103	320	62	272	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999931	0.000090

TMHMM  Annotations     

Start	End
49	68
257	279
325	347