CAZyme Information: FFUJ_11272-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_11272-t31_1-p1
• CAZy Family: GH5
• CAZyme Description: related to beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
840		91579.90	6.2998

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679033:183299-186015(+)

Full Sequence      

MVLKRATHDDVSDSFDVEHVIQNTSVSDKISLLSGRDFWHTNPLPAFNVPSVRVSDGPNG
VRGTKFVDGVPAACLPCGTGLAATWDQDLLYKAGTLIGNECIAKGAHCWLGPTVCIQRSP
LGGRGFESMAEDPYATGKLAAAYIKGVQSTGVVSVIKHWLANDQEHERVGVNVVASERAL
REIHMLPFQIALSDAAPGGVMACYNKVNGKHVSENRDFLDSLLREEWQWKGLIMSDWFGT
YSTTEAVNAGLDLEMPGPTRQRGQLLDLAVSTRKVSRSTIDTRARNVLEFVQRCANVPVA
AKEGGRDLPEDRQLNRKLAGDSVVLLKNESGQLPLKRPFKSIALIGPNMKTTSFCGGGSA
HLQPYYTVSPYDGIVAQLPPDVDVRYEVGASARGWYPLMQGGMITTPEGAPGMRMRFYSQ
SPSVPDREIIDESHLPDSSWLLMGYSHPKLDKLFYATVEGDLVIQESGPFEFGLAVYGTA
RLYVDGQLLIDNSLVQRSGTFFFGKGTIEEKAKMHLVQGQKYRITVQYESAPSSKLVKPG
VVNFGGGAGRVGLASAIDPEVGIQKAVSAALQSDVTILCVGMTSDQESEGFDRPHMDLPG
TLPRLASAVLAAAPDTIVVTQSGTPFSMLWAESAKTHVHAWLAGNETGNGIADVLFGTTC
PSGKLPLSFPRRIQDTPTFLNFGSERGRVIYGEDIYVGYRYYEKVERDVLYPFGHGLSFT
TFAYDKLNVTSAHVSFEITNSGSVPGSEVSQLYIAADEATSSIQRPKKELKGFKKTYLQP
GETKKVEIPLDRFTTSFWDEELHCWLSEKGVYAVLVGSSSNKILLEGDLHVEATTRWTGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	47	256	7.3e-61	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	7.28e-71	76	823	121	757	beta-glucosidase BglX.
224389	BglX	3.45e-60	45	348	56	363	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	2.09e-44	323	699	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	2.78e-35	75	289	88	315	Glycosyl hydrolase family 3 N terminal domain.
405066	Fn3-like	1.78e-26	748	820	1	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT75247.1|GH3	0.0	1	840	1	840
QKD62358.1|GH3	0.0	1	840	1	861
CEI61991.1|GH3	0.0	1	840	1	840
UPK90003.1|GH3	0.0	1	840	1	841
ABF50857.1|GH3	0.0	15	840	11	838

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.21e-237	15	840	4	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.03e-232	15	840	4	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.30e-132	16	836	4	673	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	6.87e-115	21	838	9	676	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	3.76e-91	41	837	43	719	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BA18|BGLK_EMENI	0.0	15	840	11	838	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
sp|Q4WA69|BGLK_ASPFU	0.0	13	704	9	690	Probable beta-glucosidase K OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglK PE=3 SV=1
sp|B0YBJ3|BGLK_ASPFC	0.0	13	704	9	666	Probable beta-glucosidase K OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglK PE=3 SV=1
sp|B0XM94|BGLH_ASPFC	1.94e-304	11	840	1	829	Probable beta-glucosidase H OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglH PE=3 SV=1
sp|Q4WL79|BGLH_ASPFU	5.52e-304	11	840	1	829	Probable beta-glucosidase H OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999894	0.000150

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_11272-t31_1-p1.