CAZyme Information: FFUJ_11193-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_11193-t31_1-p1
• CAZy Family: GH47
• CAZyme Description: related to glucuronyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
532	HF679032|CGC15	58686.37	6.5884

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679032:2497859-2499457(-)

Full Sequence      

MIPLLQDTSIAASKPFVATAKRGDMICSDSSASSTIEYEHASLSETSWSEEAAESSHERP
ALHKVLSDLFDENILAKPYRAASRVLQGFDPAHHGFPEIVPQQGPKLGRWEIREPEFWTC
GFFPGILYTLLERSIRYPRSIRAGSPGHGSSMITRGHLLPLCKSWSEPLHAMASRTDTHD
IGFIIMPALRRDFELFGSERSLGSIIQAAHNLATRYVLAAGAIRSWDCLLKKDITITDME
NNLLTIIDSMCNLDLLFYAAAQTGEQRLADIASSHATTLLKTHLRQETASSTLKSGYQGQ
LYSTCHVANIDPKTGDLKWRRTAQGYTDDSTWSRGQAWAILGYAQTYNWTKKERFLDAAC
GCAEYFLHRLETSPSCVELPVQCSSGHKSARRGRHVPLWDFDAPIENPREPLRDSSAGVI
AANGMLLISQALAGLGRYTLSGHFFDASIEIVKDTLDVCLATEKVVMTTSEDGGKSIKVE
DTVSGTTFDALLKNGTANNNENAKRRYANHGLVYGDYYLVEVGNLLLSMGLA

Enzyme Prediction     

No EC number prediction in FFUJ_11193-t31_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	113	522	2e-82	0.9756838905775076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271200	LanM-like	0.003	256	371	501	629	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT75108.1|GH88	0.0	1	532	1	532
QGJ01387.1|GH88	0.0	1	532	1	532
QGI70497.1|GH88	0.0	1	532	1	532
QGI87852.1|GH88	0.0	1	532	1	532
QKD60239.1|GH88	6.80e-311	1	531	1	536

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	1.21e-33	97	438	52	329	Crystal structure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	1.62e-23	96	370	46	282	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	1.64e-23	96	370	47	283	Crystal structure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
1VD5_A	2.32e-23	96	432	20	296	Crystal Structure of Unsaturated Glucuronyl Hydrolase, Responsible for the Degradation of Glycosaminoglycan, from Bacillus sp. GL1 at 1.8 A Resolution [Bacillus sp. GL1],2D5J_A Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2D5J_B Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2FUZ_A UGL hexagonal crystal structure without glycine and DTT molecules [Bacillus sp. GL1]
3ANI_A	7.33e-23	96	370	47	283	Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KLZ3|PLH1_FORAG	6.67e-31	118	521	77	389	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
sp|Q9A0T3|UCDH_STRP1	1.12e-27	96	425	48	316	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
sp|Q8DR77|UCDH_STRR6	4.98e-27	80	425	29	313	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
sp|Q8E372|UCDH_STRA3	8.43e-23	96	370	47	283	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
sp|Q9RC92|UGL_BACGL	1.19e-22	96	432	20	296	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999815	0.000238

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_11193-t31_1-p1.