CAZyme Information: FFUJ_11192-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_11192-t31_1-p1
• CAZy Family: GH47
• CAZyme Description: uncharacterized protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
724		81313.00	7.1611

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679032:2495306-2497480(+)

Full Sequence      

MPGLPGFSDNPFRDRHDLIRAATAIIKPLGQYRSKSNARVKLFPSTAAAFDDVAAQLEGF
ARPLWAISSLVDKSTDPSLRSWLRGIEAGVDPENPEYWGHLGSFDQRMVEMESIAFALLT
EPHVILSFLNPESTKNLEKWLQQINKFDMPRNNWRWFRVLVNLALMKVLGSDKEKARQAM
DADFELLDQFYLGEGWSSDGAWGEDRKQADYYSGSFAMQFAQLLYVHFAVDDVKRVAKYR
QQAIEFASEYWRYFDTNGAAIPFGRSMTYRFACGAFWSALALSEVQSSEPRLSLGTIKGL
LLRHLRWWAKHPEIFNSDGTMNIGYAYPNMYISEDYNSRQSVYWCLKSFVVLGLPSDHPF
WTVQEEPHPIYGLIPSARHPDNARTFPAPHQIVCHSEEHHYLLSAGQMTTKMFKAREAKY
GKFAYSSAFGYSVPTGMELHQIAPDSTLTVKLDEDGPWRVRSQPVDVRFDTILIHSAKGR
GHLPSTTSTWRPVESVDIAIQTTLIPLTYHYPGWHLRIHRIRGLGAVNGIPWFNCFEMVD
SSFAVDALTDAGYHIPANDTSKIKHHGQFAEGYVTEQASVLVKSRRGVSGIVDLTPSIHL
KGGLARDQAKLGRRGYLIQADPNTNLVSQKTLIPSIRYSGAGAAGNQSNMPVASEAPLSA
FVVTAVFGVSNVNQSMEHVPNDWYYLQDDWAYKNMLEIDVTAAGETHISIQQVTPRGASG
RGPT

Enzyme Prediction     

No EC number prediction in FFUJ_11192-t31_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH154	14	367	3.1e-121	0.9971264367816092

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
401852	DUF2264	2.20e-160	14	368	1	351	Uncharacterized protein conserved in bacteria (DUF2264). Members of this family of hypothetical bacterial proteins have no known function.
226739	COG4289	1.44e-89	10	468	23	444	Uncharacterized protein [Function unknown].
294001	SPRY_PRY_TRIM75	0.005	326	364	28	79	PRY/SPRY domain of tripartite motif-binding protein 75 (TRIM75). This domain, consisting of the distinct N-terminal PRY subdomain followed by the SPRY subdomain, is found at the C-terminus of TRIM75, also known as Gm794. TRIM75 domains are composed of RING/B-box/coiled-coil core and also known as RBCC proteins. TRIM75 has a single site of positive selection in its RING domain associated with E3 ubiquitin ligase activity. It has not been detectably expressed experimentally due to their constant turnover by the proteasome, and therefore not been characterized.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI87851.1|GH154	0.0	1	724	1	724
CCT75107.1|GH154	0.0	1	724	1	724
QGJ01386.1|GH154	0.0	1	724	1	724
QGI70496.1|GH154	0.0	1	724	1	724
QKD60238.1|GH154	0.0	1	723	1	721

PDB Hits     

FFUJ_11192-t31_1-p1 has no PDB hit.

Swiss-Prot Hits     

FFUJ_11192-t31_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999908	0.000112

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_11192-t31_1-p1.