CAZyme Information: FFUJ_10978-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_10978-t31_1-p1
• CAZy Family: GH43|CBM91
• CAZyme Description: related to endochitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417	HF679032|CGC21	45484.78	6.8276

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679032:1991376-1992835(+)

Full Sequence      

MPSFKAISASLVGLLSLGSASVIPPVNSEGYLVASTYFAGFHSTRGFPVSAMPWDKYTDV
KYAFAETTPDGSLNVSTSHPENIPCFVKDAKKHNVKPLISIGGWAGSRFLSSNIDGAKNR
TNFVKNVIDFVEKYGFEGFDIDWEYPNRQGLGCNVINKDDTANLLEFFKEIRKDPKGKNY
YITAAGSVFPWNDNTGVASKDVSGFADVLNYIMLMNYDYYGAWSAVAGPNAPLYRSCDPR
NDQGSAEDSVTKWTAAGMPASQLVLGAPNYGHGFKVNSTSAYGKSKNHKLQLYPAQNSTD
RFQGSSWDNDPLIDACGNPNPPGGTYPFWSLIKEAHFLDTKGNPASGIASAWDNCSQTPV
LYDAKREIYVSYDNAASFYDKGKFVLKNKLAGFGTYEAGGDYNNILINSIRSAVGLH

Enzyme Prediction     

No EC number prediction in FFUJ_10978-t31_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	49	404	5e-59	0.8648648648648649

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	2.65e-67	37	401	5	334	Glyco_18 domain.
225862	ChiA	1.68e-58	7	415	8	437	Chitinase, GH18 family [Carbohydrate transport and metabolism].
395573	Glyco_hydro_18	5.93e-58	37	401	5	307	Glycosyl hydrolases family 18.
119365	GH18_chitinase	2.26e-57	36	401	3	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119351	GH18_chitolectin_chitotriosidase	2.05e-46	58	392	29	332	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI87664.1|GH18	0.0	1	417	1	417
QGI70305.1|GH18	0.0	1	417	1	417
QGJ01194.1|GH18	0.0	1	417	1	417
CCT74905.1|GH18	0.0	1	417	1	417
QKD60405.1|GH18	6.61e-293	1	417	1	417

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XWF_A	1.95e-52	51	411	16	366	Chain A, Fungal chitinase from Rhizomucor miehei (SeMet-substituted proteins) [Rhizomucor miehei]
1ITX_A	6.34e-38	55	412	88	417	Chain A, Glycosyl Hydrolase [Niallia circulans]
6BT9_A	6.68e-34	90	401	153	448	Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]
6KXN_A	8.40e-32	31	410	7	366	Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KST_A	1.60e-31	31	410	7	366	Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P20533|CHIA1_NIACI	6.21e-36	55	412	120	449	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|Q95M17|CHIA_BOVIN	1.31e-30	58	416	52	389	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
sp|Q13231|CHIT1_HUMAN	4.72e-28	58	280	52	277	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|Q6RY07|CHIA_RAT	5.07e-28	58	392	52	356	Acidic mammalian chitinase OS=Rattus norvegicus OX=10116 GN=Chia PE=2 SV=1
sp|Q91XA9|CHIA_MOUSE	6.92e-28	58	392	52	356	Acidic mammalian chitinase OS=Mus musculus OX=10090 GN=Chia PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000467	0.999496	CS pos: 20-21. Pr: 0.9751

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_10978-t31_1-p1.