CAZyme Information: FFUJ_10699-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_10699-t31_1-p1
• CAZy Family: GH43
• CAZyme Description: related to DFG5 protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
445	HF679032|CGC7	48774.52	4.6726

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679032:1309484-1310920(+)

Full Sequence      

MGALQKATGLVLFLSQFASVQCMKLDSKDGILDASKGLAGDLISFYKGNETGQTPGLLPE
KRMGTDGYYWYQSGAFMGSFVDYWQLTGDKTYNKLVTEGIQWQVGKGKDFMPANNTASMG
NDDQSIWAFAALTAAEYGYPEPSEGQPQWLDLAIAVWEEQRARWDTEVEQKNCNGGLRWQ
IMMTNAGFDYKSTLANVLFFNLGARLARLTSNDTYADYASKTWDWLETSELIDKETWAVY
DGAQATKATKNCSNINQIQWSANSAGLTMGAAFMYNFTEGSDEWRKRTENLASATLKTFF
KKNGDFNEVACENSKGKCPRDIVMYKGFTHRWLAVATQVAPFTANSILPVLRKSAEGLKA
EGNGGDAMEQTFSNFVVVSNLLIDDSSAPGHQNETSKTEESPSSTSSPASKSSSAEAEGN
SAVKLAGSGSFLAFSVLMMASQWIL

Enzyme Prediction     

No EC number prediction in FFUJ_10699-t31_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	32	373	1.5e-77	0.8687150837988827

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	5.34e-132	31	357	2	312	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT74640.1|GH76	0.0	1	445	1	445
QGI87419.1|GH76	0.0	1	445	1	445
QGI70057.1|GH76	0.0	1	445	1	445
QGJ00947.1|GH76	0.0	1	445	1	445
QKD60681.1|GH76	1.80e-305	1	445	1	448

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.25e-117	9	356	13	354	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	1.04e-76	6	365	5	350	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	3.37e-76	10	365	9	347	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q05031|DFG5_YEAST	2.83e-71	13	389	17	399	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	8.10e-71	8	365	8	347	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	7.10e-70	18	365	17	352	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000248	0.999696	CS pos: 22-23. Pr: 0.9783

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_10699-t31_1-p1.