CAZyme Information: FFUJ_10698-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_10698-t31_1-p1
• CAZy Family: GH39
• CAZyme Description: probable pectate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361		36604.58	3.6954

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679032:1307273-1308407(+)

Full Sequence      

MAATLAIGAYAAPAPLITGAPSLSRRQDSEGGSGGSGGSSVLDAPMTIAAGESFDGGNAI
FDRGVSCTGQEEGGDSDAVFILEKGATLSNVRIGPNQIEGVHCNGGCTLNNVVWDAVCED
AFSIKKQEDGETTTINGGGATGAEDKVIQHNGGGTVIIKDFEVSDFGKLYRSCGNCKEMP
ARHVEISGGSASNGKILVGINPNMGDTAKISGIQLTNVPKECITFEGVTDGSEPKEVGTC
DSNAGSGSGSGSGDSTEAPATPTTPADGSETPAASEVADPVETSSDGSQGDDQSGDDQSG
DNNDSENDDSDDDNKDDNSDDENKDDQSDNENQDQDSESDNQQAQPSQPNFNFGSGGFGG
F

Enzyme Prediction     

No EC number prediction in FFUJ_10698-t31_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	38	227	1.2e-72	0.9845360824742269

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	3.74e-102	41	232	12	200	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT74639.1|PL3_2	1.55e-210	1	361	1	361
QGJ00946.1|PL3_2	1.94e-210	1	361	7	367
QGI70056.1|PL3_2	1.94e-210	1	361	7	367
QGI87418.1|PL3_2	3.00e-200	1	352	7	363
QKD60682.1|PL3_2	7.70e-200	1	361	7	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3B90_A	5.43e-25	64	236	22	205	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B90_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
1EE6_A	1.02e-24	41	232	4	188	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
3B4N_A	4.77e-24	64	236	140	323	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B4N_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_A Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
4EW9_A	3.08e-19	41	175	9	139	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	3.14e-19	41	175	10	140	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CJ49|PLYD_ASPTN	3.01e-69	41	244	42	243	Probable pectate lyase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyD PE=3 SV=1
sp|Q5ATC7|PLYH_EMENI	3.75e-69	51	237	57	243	Pectate lyase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyH PE=1 SV=1
sp|Q5B7Z3|PLYE_EMENI	8.76e-69	41	236	44	236	Pectate lyase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyE PE=1 SV=1
sp|B0YB89|PLYD_ASPFC	1.69e-68	41	244	30	232	Probable pectate lyase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyD PE=3 SV=1
sp|Q4WGV9|PLYD_ASPFU	1.69e-68	41	244	30	232	Probable pectate lyase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.434707	0.565306	CS pos: 21-22. Pr: 0.2865

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_10698-t31_1-p1.