CAZyme Information: FFUJ_10081-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_10081-t31_1-p1
• CAZy Family: GH3
• CAZyme Description: related to acetylxylan esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1215		133586.32	5.2400

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679031:317216-321182(-)

Full Sequence      

MQIKHRGLYWPLAAVSLLFISHTTAYESPDGIEPYGHGNAPDVVSWDTSWNESYPASEGD
EPSLGADRGLSSRADDFYLRVMPLGASITQGYLSTDNNGYRKWLRSQLRYKGWKVNMVGS
KQNGDMKDRDNEGWPGYVIDQVHNEFRKSMWMKPNLVLINAGTNDCNQKIDIDGAGGRMK
ALVDDIYSNIPGVTIVLSTIVRSTNVTNDACASKVSKQIRQLVKTYRGQRIGLADINPVL
PTSMLQKDGIHPTDAGYKLFASVWWDAIRKVQADIQPPAKVSGIDDAVNEKSSECKKTAG
NSRAPKQSQRGSGHDDGIYRHYSHAQGVLKSLRLENGGDSASLIKDYPWHVLFANIVLNS
ANSPRSYALDDMIRIHHEKDGTNTYWYRQNQGGGKFAASKRFDVDMDCNDGPRYAFADFN
NDGLDDFFCLKSGSAVWVSINQGGNPPKFKSIGQVVGKHDGYEATDVRIADIDGDGRADY
CLVEDSGAVICSRNGGTGVKYAWQGFKTAKGLRETVFDKNPKSAASKSGVVFADLNGDFR
DEYMWISDTGSVHTWNNMRGWGKGIVPEWRDAGLTHKGQAAKGIQNRIKFGRIYGSGRRD
YIYLRSDKTGIDMVVWENRGFGGTKRKADGNFYCDMRGTGSDDYVWIYFDGHAAELNANI
HNPPLWGNDLKIELKVPGPRVGIHLADWTGDGKCDVLVQNEATGALTLYENTYETGSKSV
TFTNKGVVTPATCSQGWGVSPFDRGMRLADIDGDGRADVMCLEPNGRITGWLNLKSGMEN
VGQVKFSEGRERADIRFADVENSGRADIIYLDKYTGAATVFKNLGRKAGTGSSFNWSNRG
VLYAPIDRGETMHFTNQGGLGRADLVHVLPFTNKAYTYFNECGASGGDDGPITDPGLPKY
STGGQDGGTDDGSEDGGGSSDDCSKPTFDGDSKVILSENFPDPSFVFDFESCTWYSFGSQ
DKGKLVQMARYNKAKDKWELLSDDPLKDAGAWGQNLDIVAPDVQWNGKQWVMYYSAFTQD
DNDGKRCIGVAFSDSIRGPYTPRDEPLVCQLDKGGVIDPSAFYDPGSDTRWVVYKIDGNR
ICGKTSIMLQQVENDGFTLKDDPVEILSETDDEKLLETPSLVYEDGSYLLFYSSGCYTSD
KYSIKYATSGSISGPYDRGDDEVLGSIAGSIQSPGSASSNGNGHLLFAAWCDKDLTTRCL
YSASYKFEDGQVTLN

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH43	939	1202	1.1e-81	0.9924528301886792
CE3	79	268	3.4e-59	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
350113	GH43_ABN-like	9.43e-95	935	1213	3	284	Glycosyl hydrolase family 43 protein such as endo-alpha-L-arabinanase. This glycosyl hydrolase family 43 (GH43) subgroup includes mostly enzymes with alpha-L-arabinofuranosidase (ABF; EC 3.2.1.55) and endo-alpha-L-arabinanase (ABN; EC 3.2.1.99) activities. These are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. The GH43 ABN enzymes hydrolyze alpha-1,5-L-arabinofuranoside linkages while the ABF enzymes cleave arabinose side chains so that the combined actions of these two enzymes reduce arabinan to L-arabinose and/or arabinooligosaccharides. These arabinan-degrading enzymes are important in the food industry for efficient production of L-arabinose from agricultural waste; L-arabinose is often used as a bioactive sweetener. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
238871	XynB_like	1.46e-39	79	268	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
350102	GH43_ABN	3.80e-23	941	1201	1	271	Glycosyl hydrolase family 43. This glycosyl hydrolase family 43 (GH43) subgroup includes mostly enzymes with alpha-L-arabinofuranosidase (ABF; EC 3.2.1.55) and endo-alpha-L-arabinanase (ABN; EC 3.2.1.99) activities. These are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. The GH43 ABN enzymes hydrolyze alpha-1,5-L-arabinofuranoside linkages while the ABF enzymes cleave arabinose side chains so that the combined actions of these two enzymes reduce arabinan to L-arabinose and/or arabinooligosaccharides. These arabinan-degrading enzymes are important in the food industry for efficient production of L-arabinose from agricultural waste; L-arabinose is often used as a bioactive sweetener. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
398349	Glyco_hydro_43	2.46e-19	934	1178	4	239	Glycosyl hydrolases family 43. The glycosyl hydrolase family 43 contains members that are arabinanases. Arabinanases hydrolyze the alpha-1,5-linked L-arabinofuranoside backbone of plant cell wall arabinans. The structure of arabinanase Arb43A from Cellvibrio japonicus reveals a five-bladed beta-propeller fold. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
350105	GH43_HoAraf43-like	3.75e-19	986	1175	43	235	Glycosyl hydrolase family 43 protein such as Halothermothrix orenii H 168 alpha-L-arabinofuranosidase (HoAraf43;Hore_20580). This glycosyl hydrolase family 43 (GH43) subgroup includes Halothermothrix orenii H 168 alpha-L-arabinofuranosidase (EC 3.2.1.55) (HoAraf43;Hore_20580). It belongs to the glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) which includes family 43 (GH43) and 62 (GH62) families. This GH43_ HoAraf43-like subgroup includes enzymes that have been annotated as having xylan-digesting beta-xylosidase (EC 3.2.1.37) and xylanase (endo-alpha-L-arabinanase, EC 3.2.1.8) activities. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many GH43 enzymes display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT73237.1|CE3|GH43_30	0.0	1	1215	1	1215
AEO70515.1|CE3	6.10e-300	38	892	42	938
UDD56943.1|CE0	4.17e-192	69	905	45	869
EAA58486.1|CE0	1.57e-138	35	899	28	918
UPK91538.1|CE0	6.09e-135	35	904	27	911

PDB Hits     

FFUJ_10081-t31_1-p1 has no PDB hit.

Swiss-Prot Hits     

FFUJ_10081-t31_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000328	0.999647	CS pos: 25-26. Pr: 0.9773

TMHMM  Annotations     

Start	End
7	26