CAZyme Information: FFUJ_09992-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_09992-t31_1-p1
• CAZy Family: GH3
• CAZyme Description: related to alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
580	HF679031|CGC5	64240.22	6.3099

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679031:566286-568028(-)

Full Sequence      

MTVKNGTYFDFIIVGGGTAGNIVAARLAENPNARILVVEAGIGTSKDNEEIRTPGLAMDI
RGSKYDWAYKTTMIKRDDYERIEKPNTRGKALGGSSSLNYFSWVPGSKGTFDMWEEYGGK
EWTWEPLVPYLRKSVTYHDDAGLYAPELKKIGAGGPIPIAHAELMPEMKPFRELLTTAWK
STGEPVSENIFDGTIRGLVHSVNTIYKGRRSGSFLAVAGKQNITIFPEVHSKRLIIDQAD
RTAKGVIVITASGEELDLYATREVIVSQGVFETPKLLMLSGIGPKAELAKHSIPLLVDSP
HVGQHLLDHPGVPFVLKIKDSYSMDNHVLRKGALQDKVMSAYANGHAGPMGSPFLEMIGF
PRIDSYLEKSPDYRAAKAANDGLDPFCPYGQPHFELDFIPLFGSAFQWHFPHPNKGSYMT
VMVDLVRPVSEGGEVTLNSADPLQQANINLNYFNNDLDIIAMREGIRFSYDVLKNGEGFK
DIVEDEYPWDMPLHDDEAMKRTVLDRSQTSFHPCGTARLAKSIEQGVVSPSLQVYGVKNL
RVIDASVIPVIPDCRIQNSVYMVAEKGADAIKRDHADLYR

Enzyme Prediction     

No EC number prediction in FFUJ_09992-t31_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	9	574	5.9e-146	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.36e-80	9	576	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.02e-76	9	580	6	546	choline dehydrogenase; Validated
398739	GMC_oxred_C	4.34e-37	428	566	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	5.90e-21	9	563	56	568	Protein HOTHEAD
366272	GMC_oxred_N	9.28e-18	88	310	23	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT73322.1|AA3_2	0.0	1	580	1	580
QGI68848.1|AA3_2	0.0	1	580	1	580
QGI99737.1|AA3_2	0.0	1	580	1	580
QKD59313.1|AA3_2	0.0	1	579	1	579
QGI86218.1|AA3_2	0.0	1	580	1	566

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	8.73e-314	5	579	3	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	2.50e-313	5	579	3	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	7.14e-313	5	579	3	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	3.59e-65	9	574	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	1.92e-64	9	574	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|M5EAX2|GMCH_MALS4	3.04e-53	5	571	43	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	3.04e-53	5	571	43	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|Q988C9|4PADH_RHILO	3.05e-53	9	571	7	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q0R4L2|PDH3_LEUMG	4.34e-53	9	576	41	600	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|Q5B8A1|PKFF_EMENI	5.19e-53	5	573	38	609	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000014	0.000033

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_09992-t31_1-p1.