CAZyme Information: FFUJ_09881-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_09881-t31_1-p1
• CAZy Family: GH3
• CAZyme Description: related to alpha-1,2-galactosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	HF679031|CGC11	36839.26	9.5087

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679031:917226-918291(-)

Full Sequence      

MHFAYPPRKNSNPPPFKQRSSQIPPILRRIRKRTAVLLLLGALGFIFFLFGLKGETPYRE
HVPSGSPPVVLVTVLDNTQYNEAYLESIRHNREQYASRNGYETMIVRASDYDTGKFPRSW
AKIIAMRHALSKYPDATYVWFLDQNAYIMELDKKLEEQVVNPAKLESLMIKDWSIVPPDS
IIKTFSHLKGEDAGLVISQDETGLVTNSFILKNGEWAKFFVETWMDPLYQSYNFQKAERH
ALEHIVQWHPTILSKLALIPQRTFASYGRNKEGNAYRDGDFVTLLVDCTVTGPTSCDKQS
HFYLQQLKNKFGDVSVKKLQ

Enzyme Prediction     

No EC number prediction in FFUJ_09881-t31_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	67	292	1.3e-70	0.9715447154471545

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	2.28e-71	65	292	1	236	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215616	PLN03181	1.27e-04	91	236	156	278	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI86320.1|GT34	2.44e-239	1	320	1	320
QGI68949.1|GT34	2.44e-239	1	320	1	320
CCT74016.1|GT34	2.44e-239	1	320	1	320
QGI99838.1|GT34	2.44e-239	1	320	1	320
QKD59427.1|GT34	6.63e-228	1	320	1	320

PDB Hits     

FFUJ_09881-t31_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13640|YGWH_SCHPO	1.17e-37	40	308	14	311	Uncharacterized alpha-1,2-galactosyltransferase C8D2.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi048 PE=3 SV=2
sp|O94622|YBKD_SCHPO	4.64e-31	84	290	123	335	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	2.14e-26	84	312	123	355	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|P46985|MNN11_YEAST	1.73e-24	54	308	147	420	Probable alpha-1,6-mannosyltransferase MNN11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN11 PE=1 SV=2
sp|P50108|MNN10_YEAST	1.63e-20	91	288	152	362	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999991	0.000014

TMHMM  Annotations     

Start	End
35	52