CAZyme Information: FFUJ_09811-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_09811-t31_1-p1
• CAZy Family: GH3
• CAZyme Description: related to N-glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
469	HF679031|CGC6	51551.00	4.8782

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679031:1115031-1116440(-)

Full Sequence      

MASHLSDVVKTATGIEQTTITGPTNTSKPHLVFGATPVDGHTYPLIRIAEDLVQRGFEVT
FIAGDQFEKSITDAGARHVTVPPLVSPKLMAEREAIPAGIPRLLYDIRHIFTGQTPERWR
ILNGVLEGIRAEDPEREVVVMPETCFMGANPISLGGPLPKGYTKRPMVINLNPIPYMATS
IDTAPFGPGLPPDSTESGHARNQFMNQMMVGGPFADVIAHQEEVLKNLGATEILEPQIPF
HHWMLMHDLSIQMCPPSLEYSRSDVPSNVKFSGCATPKPIPADFNYPSWWDDVKRGDRRI
IAVTQGTIARDATNLIIPTIDALSDRDDLLVVAILGQRGAFLPDDIPIPSNTRVIDYLAY
DALLPHASVFVMNAGYGGFLHGVTNGVPLVLAGETEDKPEIAMRGEWSGVAVNLKTGRPT
PDMVRLGVERVLRDDSFKKRVDEIKAENEAMKFFDFIEEQVLSVESFEA

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	159	458	1.4e-35	0.6832460732984293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224732	YjiC	3.97e-34	28	447	1	381	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
340817	GT1_Gtf-like	4.69e-28	29	459	1	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
273616	MGT	1.26e-22	37	447	4	372	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
278624	UDPGT	4.45e-09	258	441	237	415	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI99903.1|GT1	0.0	1	469	1	469
CCT74071.1|GT1	0.0	1	469	1	469
QGI69014.1|GT1	0.0	1	469	1	469
QGI86382.1|GT1	0.0	1	469	1	469
QKD59501.1|GT1	0.0	1	468	1	468

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6J31_A	1.02e-09	348	461	277	394	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
6J32_A	1.03e-09	348	461	280	397	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|J4VV61|GT1_BEAB2	4.00e-129	35	462	25	455	UDP-glucosyltransferase 1 OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=BBA_08686 PE=2 SV=1
sp|E7CQW6|UGTA1_STABO	6.41e-90	28	466	7	436	UDP-glucosyltransferase A1 OS=Starmerella bombicola OX=75736 GN=ugtA1 PE=1 SV=1
sp|E9L011|UGTB1_STABO	3.24e-81	28	466	5	432	UDP-glucosyltransferase B1 OS=Starmerella bombicola OX=75736 GN=ugtB1 PE=1 SV=1
sp|Q8KHE4|REBG_LENAE	1.04e-62	31	458	5	418	4'-demethylrebeccamycin synthase OS=Lentzea aerocolonigenes OX=68170 GN=rebG PE=1 SV=1
sp|P95747|TYLM2_STRFR	1.72e-06	287	447	261	420	Tylactone mycaminosyltransferase OS=Streptomyces fradiae OX=1906 GN=tylMII PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_09811-t31_1-p1.