CAZyme Information: FFUJ_09683-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_09683-t31_1-p1
• CAZy Family: GH3
• CAZyme Description: probable chitosanase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
284		30203.31	3.9879

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679031:1577649-1578657(-)

Full Sequence      

MGSLRFLLFASIATLASCRDVPDNIKALKESIIKQGSCNDTLAEGFHSADGDDGSYVYCG
DHLKDYNVIYLQGTKGKLVNMDIDCDGVQGSSADDGRCGSSGDTQSVTSFQDQLKSYGTD
QKDLDANIHPYVVFGNVGTKKNWPTFDAQKHGIKPLSVMAVVCGDKMFYGIWGDENGDDG
DEAMVGEASISLATACFGDDMNGDNGHDEDDVLYIAFPGSDAVPGEDGADWDAKNFKDFE
ESLGGVGDKLVARIEDTDSGASYLWPGTWGMGLLVASAMAAMVV

Enzyme Prediction     

EC	3.2.1.132:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	12	253	6.2e-82	0.9636363636363636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	8.31e-96	81	253	1	165	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT73515.1|GH75	5.82e-213	1	284	1	284
QGI69134.1|GH75	4.08e-211	1	284	1	285
QGJ00023.1|GH75	4.08e-211	1	284	1	285
QGI86500.1|GH75	4.08e-211	1	284	1	285
QKD59625.1|GH75	1.86e-207	1	284	1	285

PDB Hits     

FFUJ_09683-t31_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	7.97e-69	4	254	1	240	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q2U1H5|CSNB_ASPOR	5.69e-66	4	255	3	240	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q2U3M5|CSN_ASPOR	3.66e-65	11	255	10	244	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	3.66e-65	11	255	10	244	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1
sp|Q875I9|CSN_ASPFM	3.04e-62	4	255	3	237	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000254	0.999717	CS pos: 18-19. Pr: 0.9747

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_09683-t31_1-p1.