CAZyme Information: FFUJ_09368-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_09368-t31_1-p1
• CAZy Family: GH28
• CAZyme Description: related to isoamyl alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
581		63738.28	8.2534

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679031:2501871-2503810(+)

Full Sequence      

MTHLYNLIAFLIPSVLAGSVPKTCKAYPGSSDWPSHKAWSRLNDTLDGRLFAPVPPGAVC
HKGWPSYDKDTCPKVAEAWKHYDLHTQDPVSLIYDQYSNWTCLPDESYPCSGSGYPAYVV
NVTKAEDVKIGVDFARKNNIRLVVKNTGHDYIGRSIAPGSLSLWTHHLKDITYHKGSFKL
YNSKTVITGDAVTAGAGTQMYDLYTMLDKYSRVVVGGGGKTVGLGGYVTGGGHSLLSTKH
GLAVDQVLQMTMVTPSGKILTINEDNHPDLFWAMRGGGGSTFGVLTSITMKVYKTPKITA
SAFLIGTSAAAPFKYDLLAYILSQFPSLSDAGLSGYTNLSPQTPNPAGGSDEVAGIQGVF
AAQDVNDPEYILKLFKPINDTIQKRWPGYVQFSATKEEYGSFLEWYDVYFDQGAAGVTLY
LASRLLGREALGDEKEFRGALEESLVAAGGLTAHLIAGKGVRDAKPRGGSVAVNPGWRKT
YIHAISGESFEPFNKTSKAEAVKRLNRSMEPFRKLSPDTGAYINEALPFEPDWQHAFWGK
NYDRLLSIKRNVDPDDVFWCFPCVGSERWQQKDNGRLCRVK

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	114	302	1.2e-51	0.38427947598253276

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	7.78e-17	112	558	28	450	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	4.65e-13	116	263	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
369658	BBE	1.03e-11	521	559	1	39	Berberine and berberine like. This domain is found in the berberine bridge and berberine bridge- like enzymes which are involved in the biosynthesis of numerous isoquinoline alkaloids. They catalyze the transformation of the N-methyl group of (S)-reticuline into the C-8 berberine bridge carbon of (S)-scoulerine.
215242	PLN02441	2.03e-04	239	286	186	232	cytokinin dehydrogenase
273751	FAD_lactone_ox	5.21e-04	96	305	3	191	sugar 1,4-lactone oxidases. This model represents a family of at least two different sugar 1,4 lactone oxidases, both involved in synthesizing ascorbic acid or a derivative. These include L-gulonolactone oxidase (EC 1.1.3.8) from rat and D-arabinono-1,4-lactone oxidase (EC 1.1.3.37) from Saccharomyces cerevisiae. Members are proposed to have the cofactor FAD covalently bound at a site specified by Prosite motif PS00862; OX2_COVAL_FAD; 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD57322.1|GH43_11	1.38e-81	14	579	491	1065
QKD57322.1|CBM91|GH43_11	1.38e-81	14	579	491	1065
UJO23499.1|AA7	3.45e-17	116	558	63	477
AEO63154.1|AA7	7.85e-15	116	558	62	483
UQC87672.1|AA7	1.06e-14	116	322	70	259

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F72_A	1.85e-86	23	580	27	574	Crystal structure of VAO-type flavoprotein MtVAO615 at pH 7.5 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_A Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F73_B Crystal structure of VAO-type flavoprotein MtVAO615 at pH 5.0 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6F74_A	1.09e-75	17	579	24	597	Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_B Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_C Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],6F74_D Crystal structure of VAO-type flavoprotein MtVAO713 from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464]
6FYD_A	1.84e-20	116	294	45	210	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
6FYE_A	1.84e-20	116	294	45	210	The crystal structure of EncM H138T mutant [Streptomyces maritimus],6FYE_B The crystal structure of EncM H138T mutant [Streptomyces maritimus]
6FYF_A	4.37e-20	116	294	45	210	The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_B The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_C The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_D The crystal structure of EncM V135M mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1V6PBT1|CALF_PENDC	1.12e-88	7	580	7	575	Bifunctional decalin synthase calF OS=Penicillium decumbens OX=69771 GN=calF PE=1 SV=1
sp|A0A0E0RTV6|ZEB1_GIBZE	1.70e-88	24	579	27	562	FAD-linked oxidoreductase ZEB1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=ZEB1 PE=2 SV=2
sp|S0DL65|APF9_GIBF5	8.37e-87	11	580	8	585	FAD-linked oxidoreductase apf9 OS=Gibberella fujikuroi (strain CBS 195.34 / IMI 58289 / NRRL A-6831) OX=1279085 GN=apf9 PE=1 SV=1
sp|D4AS41|A7056_ARTBC	4.89e-86	3	580	6	588	Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07056 PE=1 SV=2
sp|G2QDQ9|VAO15_MYCTT	9.50e-86	23	580	27	574	VAO-type flavoprotein oxidase VAO615 OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=MYCTH_2305637 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000277	0.999714	CS pos: 17-18. Pr: 0.8710

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_09368-t31_1-p1.