CAZyme Information: FFUJ_08788-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_08788-t31_1-p1
• CAZy Family: GH18
• CAZyme Description: related to alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
612	HF679029|CGC11	66929.53	5.3252

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679029:978139-980439(-)

Full Sequence      

MLFGNFWLAFLVLFFLPLAESLHVTPDIADEQLRNVYDYIIVGGGTAGLTIANRLSENPA
VSVLVLEAGPLDDARNLSIPGGLLPVPGTIGSGGWQKYQWGLTTEPQTYLSNQSVGIPQG
KAVGGSSIFNGLCWSRGSVSDYDGWEKLGNQGWSWDDLLPYFKKSETFTFNVEPHDAQEL
YIVPQSAAHGHNGSVHVSYPQYFYDQSSNVLDGFAELGLPIIGDVNNGTAAGAMILPSSM
HPGNQTRFDAREAHFDSASLRYNLHIATNQTVTRLVLDSNSAHNSSQRVMGVEFAPNNKS
KARSVSCTREVIVSAGAIFTPTLLQVSGIGPSDVLKSLDISVKIDLPGVGYNLQDHLMVY
ANYYYRNESYFTSGEITDDVYDDVAEEYIRNRTGPWTAPLINTVAFPSLRPATKDWKQFM
DKSLGNNFPSNAPNSVKKGYELTVAAQKTFSRGTVRPSSSSIFDLPKLDPRYCSDPIDCE
IIVLGLQMNTKLIQTNAMKELMPEAESAFDTTDHETLMKHGMEKITTERHPSGTAAMMPF
ELGGVVDPELKVHGTCNLRIADASIMPLIPSAHLQASVYAIAEKAADMIKSAKPDCRTGE
RLPFPPRSRPTT

Enzyme Prediction     

No EC number prediction in FFUJ_08788-t31_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	36	591	1.2e-175	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.59e-108	35	594	4	536	choline dehydrogenase; Validated
225186	BetA	1.77e-107	37	594	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
274888	Rv0697	7.75e-62	38	589	2	486	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	2.57e-34	450	585	2	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.76e-31	112	357	16	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT71164.1|AA3_2	0.0	1	612	1	612
QGI66885.1|AA3_2	0.0	1	612	1	614
QGI97771.1|AA3_2	0.0	1	612	1	614
QGI84122.1|AA3_2	0.0	1	612	1	614
UPK94759.1|AA3_2	4.79e-302	16	611	16	624

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	1.25e-92	32	590	1	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	9.49e-79	37	591	2	563	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	5.20e-78	37	591	3	564	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6O9N_A	4.97e-73	31	589	30	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
4YNT_A	2.81e-70	37	590	6	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AUN2|XPTC_EMENI	5.24e-90	18	590	19	614	Dehydrogenase xptC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xptC PE=3 SV=1
sp|M5EAX2|GMCH_MALS4	2.18e-86	37	589	47	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	2.18e-86	37	589	47	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|Q8PPG8|BETA_XANAC	2.57e-72	33	594	1	538	Oxygen-dependent choline dehydrogenase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=betA PE=3 SV=1
sp|Q3BXK8|BETA_XANC5	6.99e-72	33	594	1	538	Oxygen-dependent choline dehydrogenase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) OX=316273 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000469	0.999504	CS pos: 21-22. Pr: 0.9726

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_08788-t31_1-p1.