CAZyme Information: FFUJ_08759-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_08759-t31_1-p1
• CAZy Family: GH18
• CAZyme Description: related to trehalase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
687		77984.09	4.8979

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679029:1077065-1079286(+)

Full Sequence      

MPSPRHIAAALAASATTVSALYVNGTVVAPCDSPIYCHGEILEQIELAQPFSDSKTFVDM
PAIRPLSEIQDAFDKLDKPLRNNSALTEFLSDYFADAGGELEEVPEDELETDPKFLDKIN
NTAIKEFTQKVIDIWPDLTRRYDQDSKNCSDCPNSFIPVNRSFVVAGGRFREPYYWDSYW
IIEGLLRTGGSFINIAKNTIENFLDFIEEYGFVPNGARIYYLNRSQPPLLSQMIKAYIEH
TNDTDILERALPLLVQEHEFFMTNRSVPVYINNETYYLNTYNVSNTRPRPESYREDYVTA
NNKSYYSPSGEVYSGGEELNFKTKEALYGNLASGAESGLDYSVKWVARPDDAIRDNYFPL
RYLNTRNIIPVDLNSILYGNEIAIAEFYEQTGNSSASRQWREVAANRSFAMHAFMWNETH
WSYFDYNLTSKAQSIFYPTDNNTAEIDKENAPKGKQVFFSPTQFYPFWLGAAPDYLKNNP
YAVLNAYKRVSYYLDTRQGGIPASNVESGQQWDQPNVWPPLMHILMSGLEKVPATFGIMD
PSFIEVRRLALRLAQRYLDSTFCTWRATGGTTSDLPRIQSAAEGADGIMFEKYADNATNV
AGGGGEYEVVEGFGWTNGVLIWAVDEFGNRLKQPQCNFTGDSSNERRDTSSAVMLHARDA
ARIKKFGNRKRAAEKATHKRSSRLFHF

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	51	626	6.9e-158	0.9938900203665988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	6.03e-141	51	628	3	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	7.23e-130	50	628	26	545	alpha,alpha-trehalase
224541	TreA	3.57e-85	33	632	53	557	Neutral trehalase [Carbohydrate transport and metabolism].
183934	treF	1.11e-68	40	619	61	538	alpha,alpha-trehalase TreF.
237326	treA	2.20e-66	33	625	43	534	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI66914.1|GH37	0.0	1	687	1	687
CCT71191.1|GH37	0.0	1	687	1	687
QGI97800.1|GH37	0.0	1	687	1	687
QKD58312.1|GH37	0.0	1	687	1	687
QGI84151.1|GH37	0.0	1	687	1	666

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	5.04e-73	53	628	40	555	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	7.11e-72	53	628	40	555	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
5Z66_A	4.38e-56	33	632	46	544	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JG0_A	2.30e-54	39	625	15	500	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	3.59e-51	39	625	15	500	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	2.21e-114	21	636	39	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|Q9JLT2|TREA_MOUSE	1.10e-104	30	631	24	551	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|A8J4S9|TREA_APIME	1.68e-103	22	631	32	572	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1
sp|O43280|TREA_HUMAN	4.01e-103	30	631	27	554	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|P19813|TREA_RABIT	3.11e-100	30	631	27	553	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.992092	0.007945

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_08759-t31_1-p1.