CAZyme Information: FFUJ_08723-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_08723-t31_1-p1
• CAZy Family: GH18
• CAZyme Description: related to SPR1-exo-1,3-beta-glucanase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336	HF679029|CGC11	39154.68	6.5046

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679029:1175861-1177025(+)

Full Sequence      

MRTTTFITAVVALTASANAWLPNTETHALNDHDNEIFVYPLRTEPNNKRWLPAAKKIRGV
NLGSLFIFEPWIDSQEWANTGYKNFQAHLKRWINQTDLDEILHGAPGAQEPNQPFTGQYA
PTVGFYSDQYYERAIEWLEWMTDMIHTKKEYRNVGMLELVNEPLNWDNAVASLRKTYYPK
AYSAIRKVEDKLKVTSNNRLHIQMMGSLWGSGKPTEFLSDTSFTAFDDHRYLKWDTSVEA
SHEAYIEKSCSDDRNTDGPTIVGEWSLAVPDDVEKTNAWNPHTQKGFYTKRFSAQVHAYE
KHTLGWVFWTWKANLGDDYRWSYRGELQFSKRTHDY

Enzyme Prediction     

No EC number prediction in FFUJ_08723-t31_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	102	324	1.5e-112	0.7366666666666667

CDD Domains     

FFUJ_08723-t31_1-p1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT71223.1|GH5_15	7.22e-265	1	336	1	336
QGI66947.1|GH5_15	7.22e-265	1	336	1	336
QGI97833.1|GH5_15	7.22e-265	1	336	1	336
QGI84184.1|GH5_15	7.22e-265	1	336	1	336
UPK93324.1|GH5_15	2.05e-177	1	324	1	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3O6A_A	8.71e-07	46	324	3	375	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
2PB1_A	2.74e-06	46	324	4	376	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PF0_A	2.74e-06	46	324	4	376	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PBO_A	6.45e-06	46	324	4	376	Chain A, Hypothetical protein XOG1 [Candida albicans]
2PC8_A	6.45e-06	46	324	4	376	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B6Q3|EXGB_EMENI	2.72e-110	17	324	14	388	Glucan endo-1,6-beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgB PE=2 SV=1
sp|B0XRX9|EXGB_ASPFC	1.29e-102	7	331	5	385	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgB PE=3 SV=1
sp|Q0C8Z0|EXGB_ASPTN	3.31e-102	11	324	12	382	Probable glucan endo-1,6-beta-glucosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgB PE=3 SV=1
sp|A1DGM6|EXGB_NEOFI	4.13e-102	7	324	5	378	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgB PE=3 SV=1
sp|Q4X1N4|EXGB_ASPFU	1.46e-101	7	331	5	385	Probable glucan endo-1,6-beta-glucosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000416	0.999559	CS pos: 19-20. Pr: 0.9729

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_08723-t31_1-p1.