CAZyme Information: FFUJ_07576-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_07576-t31_1-p1
• CAZy Family: GH16
• CAZyme Description: related to endo alpha-1,4 polygalactosaminidase precusor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343	HF679027|CGC19	37920.30	9.5904

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679027:2632417-2633501(+)

Full Sequence      

MATNAAEDATSEKPHVAKAKRSWPLWKKLTAFSVTLSVIIALAVGLGVGLTRGKGGSNSD
DTANSETDDSTEPYLKARSSLWQPKVGAQWQIVLLKPIKLNKAGSAKDLKPNVGIYDLDL
YDNDAETFVALHKAGKKVICYFSAGSWEDWRDDKNQFNKADLGKTLDGWPDEKWLNLRST
NVRNIMKKRIKLAAQKGCDAIDPDNVDGYQNDNGLKLTKKDSIDYIKFLAAEAAKYNMST
GLKNAGDIISSVLPYVQFSVNEQCVEYSECETFAKFIKAKKPVFNIEYPKGAPKVKESDR
KAICSKKGKAKGTEGFSTVIKKMNLDGWVMYCTGNTYQTAVKN

Enzyme Prediction     

No EC number prediction in FFUJ_07576-t31_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH114	90	288	4.5e-76	0.9947368421052631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397552	Glyco_hydro_114	4.54e-116	90	327	2	221	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
226386	COG3868	7.42e-33	108	288	75	266	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI95594.1|GH114	1.22e-246	1	343	1	343
CCT68763.1|GH114	1.22e-246	1	343	1	343
QGI81969.1|GH114	1.22e-246	1	343	1	343
QGI64708.1|GH114	1.22e-246	1	343	1	343
QKD54655.1|GH114	1.77e-237	1	343	1	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6OJ1_A	6.85e-92	69	332	21	277	Crystal Structure of Aspergillus fumigatus Ega3 [Aspergillus fumigatus Af293]
6OJB_A	1.19e-91	69	332	38	294	Crystal Structure of Aspergillus fumigatus Ega3 complex with galactosamine [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

FFUJ_07576-t31_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000022

TMHMM  Annotations     

Start	End
29	51