CAZyme Information: FFUJ_06783-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_06783-t31_1-p1
• CAZy Family: GH131
• CAZyme Description: related to acetylxylan esterase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
234	HF679027|CGC13	24655.62	7.8262

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679027:202470-203306(-)

Full Sequence      

MSKIAFLTFLFLIPLAIGAPSVDIEERQAPCQNVHIFLARGTDEPYPGRQSSLVSAICSG
LPSCGYENINYPANFNTYCTSIYAGITGGLSQITAYANRCPDSKLVLSGYSQGAQLFGDM
LGGGGGQSLGCTQQSNSALNPATSPGNKIAAVLFFGDPRHAASQAYNTGTGASRNGINPR
NGAQLTSLNRYSNKIRSWCLAGDNVCAQGTDPSAHTSYFNVFSQEAGAWVKTMV

Enzyme Prediction     

No EC number prediction in FFUJ_06783-t31_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	30	232	1.9e-42	0.9841269841269841

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	3.73e-30	30	231	1	170	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT68028.1|CE5	5.09e-173	1	234	1	234
QGI81251.1|CE5	2.42e-171	1	234	1	234
QGI63982.1|CE5	4.02e-170	1	234	1	234
QGI94864.1|CE5	3.26e-149	1	234	1	216
CZS83092.1|CE5	6.23e-149	1	234	1	234

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1BS9_A	6.01e-28	31	232	2	204	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	6.01e-28	31	232	2	204	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
2AXE_A	6.01e-28	31	232	2	204	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
1QOZ_A	2.34e-27	31	234	2	206	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]
4PSC_A	2.56e-10	25	158	73	194	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O59893|AXE2_TALPU	1.40e-28	15	232	11	231	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|Q99034|AXE1_HYPJE	8.53e-27	15	234	17	237	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|A0A2J8C362|CUTI1_VERDA	2.24e-21	21	232	16	227	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|B9U443|CUTI1_COPCI	1.14e-12	16	158	16	146	Cutinase CUT1 OS=Coprinopsis cinerea OX=5346 GN=CUT1 PE=1 SV=1
sp|P63880|CULP1_MYCBO	1.04e-11	17	218	21	196	Carboxylesterase Culp1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB2006C PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000197	0.999759	CS pos: 27-28. Pr: 0.4283

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_06783-t31_1-p1.