CAZyme Information: FFUJ_06401-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_06401-t31_1-p1
• CAZy Family: GH12
• CAZyme Description: probable chitosanase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
252	HF679028|CGC9	26384.25	4.7374

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679028:3475896-3476702(+)

Full Sequence      

MHSCSFLTAVTLGTAASAYQLPQNLKSIYDNHKAGSCSNRLSDRFPEGARYCGDISGAIY
LKGSNGNYDNMDIDCDGANNHAGACSNDPSGQGETAFKDTVKNYGIPDLDANVHPYVVFG
NDGASPSFDPQQHGIKPLSVMAVVCNGEVVSIPQSIIDFLLTLNSTTASGETLTVAPLST
GEASISLAELCFPNQGLNGDNGHGEKDVLYIGFKGDEAVPGKNGADWKAASRADFSKSIR
ALGDKLVAKLQG

Enzyme Prediction     

EC	3.2.1.132:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH75	7	150	2.5e-44	0.6272727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
399960	Glyco_hydro_75	3.99e-89	71	249	1	165	Fungal chitosanase of glycosyl hydrolase group 75. This family consists of several fungal chitosanase proteins. Chitin, xylan, 6-O-sulphated chitosan and O-carboxymethyl chitin are indigestible by chitosanase. EC:3.2.1.132. The mechanism is likely to be inverting, and the probable catalytic neutrophile base is Asp, with the probable catalytic proton donor being Glu. (see the Chitosanase web-page from CAZY).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT70428.1|GH75	1.84e-184	1	252	1	252
QGI83540.1|GH75	2.34e-158	1	252	1	235
QGI66296.1|GH75	7.83e-157	1	252	1	235
QGI97180.1|GH75	7.83e-157	1	252	1	235
QKD56405.1|GH75	5.13e-135	1	250	1	227

PDB Hits     

FFUJ_06401-t31_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WB37|CSN_ASPFU	3.97e-91	16	250	16	240	Endo-chitosanase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=csn PE=3 SV=1
sp|Q2U1H5|CSNB_ASPOR	4.51e-85	5	251	4	240	Endo-chitosanase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csnB PE=3 SV=1
sp|Q875I9|CSN_ASPFM	6.67e-84	5	251	4	237	Endo-chitosanase OS=Neosartorya fumigata OX=746128 GN=csn PE=1 SV=1
sp|Q2U3M5|CSN_ASPOR	1.19e-83	7	251	6	244	Endo-chitosanase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=csn PE=3 SV=1
sp|Q9P961|CSN_ASPOZ	1.19e-83	7	251	6	244	Endo-chitosanase OS=Aspergillus oryzae OX=5062 GN=csn PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001322	0.998638	CS pos: 18-19. Pr: 0.9466

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_06401-t31_1-p1.