CAZyme Information: FFUJ_05667-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_05667-t31_1-p1
• CAZy Family: GH1
• CAZyme Description: related to endoglucanase c

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
294	HF679028|CGC29	32342.60	8.2435

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679028:1044436-1045420(-)

Full Sequence      

MRTAAFITLLASVVSATPFGQRSQVLARASETCPVVFDGRVPANASLTDFDTANGGGWNP
YNPGFVKGNNISWSEILQLPKTKTKSRFDTEAGTIPLEVTISDKSIFMKQLGFRRAGLQF
NKDSNEGSLGSKGVKTLHFSIMQDDKRPLNLSHEYLNVWHEKADFSGNQFQFQAGQLIGQ
NGTAATWKLLDQDFKLLWETPMLKKVWQNFAITLNYEKNTIQAYYSKGCKPLNVATQPIA
RNLTGQGQFQIGILKKPTGTDDVANAGFQEANLNEGLIYGGIFLEDSADGCVSL

Enzyme Prediction     

No EC number prediction in FFUJ_05667-t31_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH131	35	290	7.2e-67	0.9725490196078431

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408085	GH131_N	1.17e-97	35	290	1	251	Glycoside hydrolase 131 catalytic N-terminal domain. This is the N-terminal domain found in glycoside hydrolase family 131 (GH131A) protein observed in Coprinopsis cinerea. GH131A exhibits bifunctional exo-beta-1,3-/-1,6- and endo-beta-1,4 activity toward beta-glucan. This domain is catalytic in nature though the catalytic mechanism of C. cinerea GH131A is different from that of typical glycosidases that use a pair of carboxylic acid residues as the catalytic residues. In the case of GH131A, Glu98 and His218 may form a catalytic dyad and Glu98 may activate His218 during catalysis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCT69757.1|GH131	3.38e-217	1	294	1	294
QGI96469.1|GH131	3.95e-216	1	294	1	294
QGI65589.1|GH131	3.95e-216	1	294	1	294
QGI82835.1|GH131	3.95e-216	1	294	1	294
QKD55659.1|GH131	5.38e-214	1	294	1	294

PDB Hits     

FFUJ_05667-t31_1-p1 has no PDB hit.

Swiss-Prot Hits     

FFUJ_05667-t31_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000288	0.999676	CS pos: 28-29. Pr: 0.6037

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_05667-t31_1-p1.