CAZyme Information: FFUJ_05472-t31_1-p1

Basic Information

• Species: Fusarium fujikuroi
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium fujikuroi
• CAZyme ID: FFUJ_05472-t31_1-p1
• CAZy Family: CE5
• CAZyme Description: endo-1,4-beta-xylanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231		25719.00	6.8670

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FfujikuroiIMI58289	15099	1279085	286	14813

• Gene Location: location=HF679028:360074-360874(-)

Full Sequence      

MVSFKSLLLAASALTGALARPFDFLDEQDDGNSTSVLEARQVTGNSEGYHNGYFYSWWSD
GGGYANYRMGEGSHYQVDWRNTGNFVGGKGWNPGTGRTINYGGSFSPQGNGYLCVYGWTR
SPLVEYYVIENYGTYNPGSAGQHKGTVYNDGDTYDLYQTTRYQQPSIDGIQTFNQYWAIR
RNKRSSGAVNMQTIFNAWSSAGMRLGNHYYQILATEGYQSSGSSSIYVQTK

Enzyme Prediction     

EC	3.2.1.8:61

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	51	226	2e-70	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	8.56e-98	51	225	1	175	Glycosyl hydrolases family 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI82653.1|GH11	3.46e-174	1	231	1	231
QGI65403.1|GH11	3.46e-174	1	231	1	231
CCT69575.1|GH11	3.46e-174	1	231	1	231
QGI96284.1|GH11	3.46e-174	1	231	1	231
QKD55466.1|GH11	1.52e-170	1	230	1	230

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZSE_A	4.81e-78	42	230	2	188	3D Structure of a thermophilic family GH11 xylanase from Thermobifida fusca [Thermobifida fusca]
1PVX_A	3.11e-77	42	228	2	190	Chain A, Protein (endo-1,4-beta-xylanase) [Paecilomyces variotii]
5EJ3_A	4.04e-77	42	228	45	230	Crystal structure of XlnB2 [Streptomyces lividans],5EJ3_B Crystal structure of XlnB2 [Streptomyces lividans]
1M4W_A	4.86e-77	42	226	4	186	Thermophilic b-1,4-xylanase from Nonomuraea flexuosa [Thermopolyspora flexuosa]
7EO6_A	3.71e-76	42	226	6	188	Chain A, Endo-1,4-beta-xylanase [Actinomycetia bacterium],7EO6_B Chain B, Endo-1,4-beta-xylanase [Actinomycetia bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1S2K3|XYNA_GIBZE	2.19e-159	1	230	1	230	Endo-1,4-beta-xylanase A OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=XYLA PE=1 SV=1
sp|Q9HGE1|XYN2_HUMGT	6.75e-121	1	230	1	226	Endo-1,4-beta-xylanase 2 OS=Humicola grisea var. thermoidea OX=5528 GN=xyn2 PE=1 SV=1
sp|P55334|XYN1_HUMIN	1.93e-120	1	230	1	226	Endo-1,4-beta-xylanase 1 OS=Humicola insolens OX=34413 GN=XYL1 PE=2 SV=1
sp|Q0ZHI9|XYNG_VERDA	7.12e-119	1	231	1	233	Endo-1,4-beta-xylanase G OS=Verticillium dahliae OX=27337 GN=xynG PE=1 SV=1
sp|P55332|XYNA_EMENI	8.47e-98	1	228	1	224	Endo-1,4-beta-xylanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xlnA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000319	0.999687	CS pos: 19-20. Pr: 0.9726

TMHMM  Annotations     

There is no transmembrane helices in FFUJ_05472-t31_1-p1.